Anti-alpha 1 Fetoprotein antibody [C2] - BSA and Azide free (ab212325)

Overview

  • Product name

    Anti-alpha 1 Fetoprotein antibody [C2] - BSA and Azide free
    See all alpha 1 Fetoprotein primary antibodies
  • Description

    Mouse monoclonal [C2] to alpha 1 Fetoprotein - BSA and Azide free
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, ICC/IF, Flow Cytmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Chimpanzee, GorillaDoes not react with: Rat, Cow, Dog
  • Immunogen

    Full length native protein (purified) corresponding to Human alpha 1 Fetoprotein aa 19-609. purified from serum of a hepatoma patient.
    Sequence:

    RTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVK DALTAIEKPTGDEQSSGCLENQLPAFLEELCHEKEILEKYGHSDCCSQSE EGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIAR RHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVTKELRESSL LNQHACAVMKNFGTRTFQAITVTKLSQKFTKVNFTEIQKLVLDVAHVHEH CCRGDVLDCLQDGEKIMSYICSQQDTLSNKITECCKLTTLERGQCIIHAE NDEKPEGLSPNLNRFLGDRDFNQFSSGEKNIFLASFVHEYSRRHPQLAVS VILRVAKGYQELLEKCFQTENPLECQDKGEEELQKYIQESQALAKRSCGL FQKLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEDK LLACGEGAADIIIGHLCIRHEMTPVNPGVGQCCTSSYANRRPCFSSLVVD ETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVK QKPQITEE QLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV


    Database link: P02771

  • Positive control

    • HepG2 cells; Human fetal liver or hepatocellular carcinoma tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab212325 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 1 - 2 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

for 30 minutes at RT

ICC/IF Use a concentration of 0.5 - 1 µg/ml.
Flow Cyt Use 0.5-1µg for 106 cells.

in 0.1ml volume

Target

  • Function

    Binds copper, nickel, and fatty acids as well as, and bilirubin less well than, serum albumin. Only a small percentage (less than 2%) of the human AFP shows estrogen-binding properties.
  • Tissue specificity

    Plasma. Synthesized by the fetal liver and yolk sac.
  • Sequence similarities

    Belongs to the ALB/AFP/VDB family.
    Contains 3 albumin domains.
  • Developmental stage

    Occurs in the plasma of fetuses more than 4 weeks old, reaches the highest levels during the 12th-16th week of gestation, and drops to trace amounts after birth. The serum level in adults is usually less than 40 ng/ml. AFP occurs also at high levels in the plasma and ascitic fluid of adults with hepatoma.
  • Post-translational
    modifications

    Independent studies suggest heterogeneity of the N-terminal sequence of the mature protein and of the cleavage site of the signal sequence.
    Sulfated.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Afp antibody
    • AFPD antibody
    • Alpha fetoglobulin antibody
    • Alpha fetoprotein antibody
    • Alpha fetoprotein precursor antibody
    • Alpha-1-fetoprotein antibody
    • Alpha-fetoglobulin antibody
    • Alpha-fetoprotein antibody
    • alpha-fetoprotein, Hereditary persistence of, included antibody
    • FETA antibody
    • FETA_HUMAN antibody
    • Hereditary persistence of alpha fetoprotein antibody
    • HPAFP antibody
    see all

Images

  • Immunohistochemical analysis of formalin fixed, paraffin embedded Human fetal liver tissue labeling alpha 1 Fetoprotein with ab212325 at 2 ug/ml.

References

ab212325 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab212325.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up