Overview

  • Product name

    Anti-alpha 1 Glycine Receptor/GLRA1 antibody
    See all alpha 1 Glycine Receptor/GLRA1 primary antibodies
  • Description

    Rabbit polyclonal to alpha 1 Glycine Receptor/GLRA1
  • Host species

    Rabbit
  • Specificity

    ab26134 recognises Glycine receptor alpha-1 chain precursor (GLRA1).
  • Tested applications

    Suitable for: ELISA, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to alpha 1 Glycine Receptor/GLRA1 aa 190-239.
    Sequence:

    TMNDLIFEWQEQGAVQVADGLTLPQFILKEEKDLRYCTKHYNTGKFTCIE

  • Positive control

    • Raji cell lysate
  • General notes

     This product was previously labelled as alpha 1 Glycine Receptor

     

Properties

Applications

Our Abpromise guarantee covers the use of ab26134 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA 1/62500.
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 51 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    The glycine receptor is a neurotransmitter-gated ion channel. Binding of glycine to its receptor increases the chloride conductance and thus produces hyperpolarization (inhibition of neuronal firing).
  • Involvement in disease

    Defects in GLRA1 are a cause of startle disease (STHE) [MIM:149400]; also known as hereditary hyperekplexia or congenital stiff-person syndrome. STHE is a genetically heterogeneous neurologic disorder characterized by muscular rigidity of central nervous system origin, particularly in the neonatal period, and by an exaggerated startle response to unexpected acoustic or tactile stimuli. Inheritance can be autosomal dominant or recessive.
  • Sequence similarities

    Belongs to the ligand-gated ion channel (TC 1.A.9) family. Glycine receptor (TC 1.A.9.3) subfamily. GLRA1 sub-subfamily.
  • Cellular localization

    Cell junction > synapse > postsynaptic cell membrane. Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • GLRA1 antibody
    • GLRA1_HUMAN antibody
    • Glycine receptor 48 kDa subunit antibody
    • Glycine receptor alpha 1 antibody
    • Glycine receptor strychnine-binding subunit antibody
    • Glycine receptor subunit alpha-1 antibody
    • Glycine receptor, alpha 1 subunit antibody
    • HKPX1 antibody
    • STHE antibody
    see all

Images

  • Anti-alpha 1 Glycine Receptor/GLRA1 antibody (ab26134) at 1 µg/ml + Raji cell lysate

    Predicted band size: 51 kDa

References

This product has been referenced in:

  • Hufnagel LA  et al. Immunocytochemical localization of a putative strychnine-sensitive glycine receptor in Hydra vulgaris. Cell Tissue Res N/A:N/A (2019). Read more (PubMed: 30976918) »
See 1 Publication for this product

Customer reviews and Q&As

Answer

Thank you for your enquiry regarding our antibody to alpha 1 glycine receptor. To my knowledge, there is no experimental data on whether this antibody will also recognise alpha2 glysine receptor. I have done a BLAST sequence alignment analogy search, and there is 76% homology between these two peptides. We would normally recommend that an antibody has over 85% homology before we can predict the antibody will detect it. This is fairly close, so it may give weak binding. I hope this helps. Please get back to me if you have any more questions, and I will be happy to help.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up