Overview

  • Product name

    Anti-Alpha 2 Antiplasmin antibody
    See all Alpha 2 Antiplasmin primary antibodies
  • Description

    Rabbit polyclonal to Alpha 2 Antiplasmin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Rat Alpha 2 Antiplasmin aa 348-491. Expressed in E.coli.
    Sequence:

    VATLSKLGLQDLFQSPDLRGISDQSLVVSSVQHQSTMELSEAGVEAAAAT STAMTRMSLSSFFLNRPFIFFIMEETIGIPLFVGSVRNPDPSAQPQPQEQ QDSPDNRRLDQNDKADIPGGKTFAPDLKLVPRLEEDYPQFSSPK


    Database link: Q68FT8

  • Positive control

    • WB: Recombinant rat Alpha 2 Antiplasmin protein; Mouse liver lysate. IHC-P: Rat adrenal gland and liver tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab231226 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 55 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Serine protease inhibitor. The major targets of this inhibitor are plasmin and trypsin, but it also inactivates matriptase-3/TMPRSS7 and chymotrypsin.
  • Tissue specificity

    Expressed by the liver and secreted in plasma.
  • Involvement in disease

    Defects in SERPINF2 are the cause of alpha-2-plasmin inhibitor deficiency (APLID) [MIM:262850]. APLID is an autosomal recessive disorder resulting in severe hemorrhagic diathesis.
  • Sequence similarities

    Belongs to the serpin family.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • A2AP antibody
    • A2AP_HUMAN antibody
    • AAP antibody
    • Alpha 2 antiplasmin antibody
    • Alpha 2 antiplasmin pigment epithelium derived factor antibody
    • Alpha 2 AP antibody
    • ALPHA 2 PI antibody
    • Alpha 2 plasmin inhibitor antibody
    • Alpha 2 plasmin inhibitor deficiency antibody
    • Alpha-2-antiplasmin antibody
    • Alpha-2-AP antibody
    • Alpha-2-PI antibody
    • Alpha-2-plasmin inhibitor antibody
    • Antiplasmin deficiency antibody
    • API antibody
    • Plasmin inhibitor deficiency antibody
    • PLI antibody
    • Serine (or cysteine) peptidase inhibitor, clade F, member 2 antibody
    • Serine (Or cysteine) peptidase inhibitor, clade F, member 2, isoform CRA_c antibody
    • Serine (or cysteine) proteinase inhibitor, clade F (alpha 2 antiplasmin pigment epithelium derived factor) member 2 antibody
    • Serine (Or cysteine) proteinase inhibitor, clade F, member 2 antibody
    • Serine or cysteine peptidase inhibitor clade F member 2 antibody
    • Serpin F2 antibody
    • Serpin peptidase inhibitor clade F antibody
    • Serpin peptidase inhibitor, clade F (alpha 2 antiplasmin pigment epithelium derived factor) member 2 antibody
    • SERPINF2 antibody
    see all

Images

  • Anti-Alpha 2 Antiplasmin antibody (ab231226) at 2 µg/ml + Mouse liver lysate

    Predicted band size: 55 kDa

  • Anti-Alpha 2 Antiplasmin antibody (ab231226) at 2 µg/ml + Recombinant rat Alpha 2 Antiplasmin protein

    Predicted band size: 55 kDa

  • Formalin-fixed, paraffin-embedded rat liver tissue stained for Alpha 2 Antiplasmin using ab231226 at 2 µg/mL in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded rat adrenal tissue stained for Alpha 2 Antiplasmin using ab231226 at 2 µg/mL in immunohistochemical analysis. DAB staining.

References

ab231226 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231226.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up