Overview

  • Product name

    Anti-alpha 2 Macroglobulin antibody
    See all alpha 2 Macroglobulin primary antibodies
  • Description

    Goat polyclonal to alpha 2 Macroglobulin
  • Host species

    Goat
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Full length native protein (purified) corresponding to Human alpha 2 Macroglobulin aa 24-1474. (From Human plasma).
    Sequence:

    SVSGKPQYMVLVPSLLHTETTEKGCVLLSYLNETVTVSASLESVRGNRSL FTDLEAENDVLHCVAFAVPKSSSNEEVMFLTVQVKGPTQEFKKRTTVMVK NEDSLVFVQTDKSIYKPGQTVKFRVVSMDENFHPLNELIPLVYIQDPKGN RIAQWQSFQLEGGLKQFSFPLSSEPFQGSYKVVVQKKSGGRTEHPFTVEE FVLPKFEVQVTVPKIITILEEEMNVSVCGLYTYGKPVPGHVTVSICRKYS DASDCHGEDSQAFCEKFSGQLNSHGCFYQQVKTKVFQLKRKEYEMKLHTE AQIQEEGTVVELTGRQSSEITRTITKLSFVKVDSHFRQGIPFFGQVRLVD GKGVPIPNKVIFIRGNEANYYSNATTDEHGLVQFSINTTNVMGTSLTVRV NYKDRSPCYGYQWVSEEHEEAHHTAYLVFSPSKSFVHLEPMSHELPCGHT QTVQAHYILNGGTLLGLKKLSFYYLIMAKGGIVRTGTHGLLVKQEDMKGH FSISIPVKSDIAPVARLLIYAVLPTGDVIGDSAKYDVENCLANKVDLSFS PSQSLPASHAHLRVTAAPQSVCALRAVDQSVLLMKPDAELSASSVYNLLP EKDLTGFPGPLNDQDNEDCINRHNVYINGITYTPVSSTNEKDMYSFLEDM GLKAFTNSKIRKPKMCPQLQQYEMHGPEGLRVGFYESDVMGRGHARLVHV EEPHTETVRKYFPETWIWDLVVVNSAGVAEVGVTVPDTITEWKAGAFCLS EDAGLGISSTASLRAFQPFFVELTMPYSVIRGEAFTLKATVLNYLPKCIR VSVQLEASPAFLAVPVEKEQAPHCICANGRQTVSWAVTPKSLGNVNFTVS AEALESQELCGTEVPSVPEHGRKDTVIKPLLVEPEGLEKETTFNSLLCPS GGEVSEELSLKLPPNVVEESARASVSVLGDILGSAMQNTQNLLQMPYGCG EQNMVLFAPNIYVLDYLNETQQLTPEIKSKAIGYLNTGYQRQLNYKHYDG SYSTFGERYGRNQGNTWLTAFVLKTFAQARAYIFIDEAHITQALIWLSQR QKDNGCFRSSGSLLNNAIKGGVEDEVTLSAYITIALLEIPLTVTHPVVRN ALFCLESAWKTAQEGDHGSHVYTKALLAYAFALAGNQDKRKEVLKSLNEE AVKKDNSVHWERPQKPKAPVGHFYEPQAPSAEVEMTSYVLLAYLTAQPAP TSEDLTSATNIVKWITKQQNAQGGFSSTQDTVVALHALSKYGAATFTRTG KAAQVTIQSSGTFSSKFQVDNNNRLLLQQVSLPELPGEYSMKVTGEGCVY LQTSLKYNILPEKEEFPFALGVQTLPQTCDEPKAHTSFQISLSVSYTGSR SASNMAIVDVKMVSGFIPLKPTVKMLERSNHVSRTEVSSNHVLIYLDKVS NQTLSLFFTVLQDVPVRDLKPAIVKVYDYYETDEFAIAEYNAPCSKDLGN A


    Database link: P01023

  • Positive control

    • Human alpha 2 Macroglobulin.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.01% Sodium azide
    Constituents: 0.27% Potassium phosphate, 0.88% Sodium chloride
  • Concentration information loading...
  • Purity

    IgG fraction
  • Purification notes

    ab181656 is purified from monospecific antiserum by a multi-step process which includes delipidation, salt fractionation and ion exchange chromatography followed by extensive dialysis against the buffer stated above.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab181656 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use at an assay dependent concentration.
WB 1/2000 - 1/20000. Predicted molecular weight: 163 kDa.

Target

  • Function

    Is able to inhibit all four classes of proteinases by a unique 'trapping' mechanism. This protein has a peptide stretch, called the 'bait region' which contains specific cleavage sites for different proteinases. When a proteinase cleaves the bait region, a conformational change is induced in the protein which traps the proteinase. The entrapped enzyme remains active against low molecular weight substrates (activity against high molecular weight substrates is greatly reduced). Following cleavage in the bait region a thioester bond is hydrolyzed and mediates the covalent binding of the protein to the proteinase.
  • Tissue specificity

    Secreted in plasma.
  • Sequence similarities

    Belongs to the protease inhibitor I39 (alpha-2-macroglobulin) family.
  • Developmental stage

    Contrary to the rat protein, which is an acute phase protein, this protein is always present at high levels in circulation.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • A2m antibody
    • A2MG_HUMAN antibody
    • Alpha 2 M antibody
    • Alpha 2M antibody
    • Alpha-2-M antibody
    • Alpha-2-macroglobulin antibody
    • C3 and PZP-like alpha-2-macroglobulin domain-containing protein 5 antibody
    • CPAMD5 antibody
    • DKFZp779B086 antibody
    • FWP007 antibody
    • S863 7 antibody
    see all

Images

  • Anti-alpha 2 Macroglobulin antibody (ab181656) at 1/1000 dilution + Human alpha 2 Macroglobulin at 0.05 µg

    Secondary
    Peroxidase anti-Goat at 1/40000 dilution

    Predicted band size: 163 kDa

  • All lanes : Anti-alpha 2 Macroglobulin antibody (ab181656) at 1/3000 dilution

    Lane 1 : Alpha 2 Macroglobulin under reducing (R) conditions
    Lane 2 : Alpha 2 Macroglobulin under non-reducing (NR) conditions

    Lysates/proteins at 1 µg per lane.

    Secondary
    All lanes : Dylight 649 conjugated Donkey anti goat at 1/10000 dilution

    Predicted band size: 163 kDa



    Reduced samples of purified protein contained 4% BME and were boiled for 5 minutes.

References

ab181656 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181656.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up