Anti-alpha 3 Sodium Potassium ATPase antibody (ab176598)

Overview

  • Product name
    Anti-alpha 3 Sodium Potassium ATPase antibody
    See all alpha 3 Sodium Potassium ATPase primary antibodies
  • Description
    Rabbit polyclonal to alpha 3 Sodium Potassium ATPase
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken
  • Immunogen

    Recombinant fragment corresponding to Human alpha 3 Sodium Potassium ATPase aa 449-643.
    Sequence:

    CIELSSGSVKLMRERNKKVAEIPFNSTNKYQLSIHETEDPNDNRYLLVMK GAPERILDRCSTILLQGKEQPLDEEMKEAFQNAYLELGGLGERVLGFCHY YLPEEQFPKGFAFDCDDVNFTTDNLCFVGLMSMIDPPRAAVPDAVGKCRS AGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVS


    Database link: P13637

  • Positive control
    • 293 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab176598 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Predicted molecular weight: 111 kDa.

Target

  • Function
    This is the catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of sodium and potassium ions across the plasma membrane. This action creates the electrochemical gradient of sodium and potassium ions, providing the energy for active transport of various nutrients.
  • Involvement in disease
    Dystonia 12
    Alternating hemiplegia of childhood 2
    Cerebellar ataxia, areflexia, pes cavus, optic atrophy, and sensorineural hearing loss
  • Sequence similarities
    Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIC subfamily.
  • Cellular localization
    Cell membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • AHC2 antibody
    • Alpha(III) antibody
    • AT1A3_HUMAN antibody
    • Atp1a3 antibody
    • ATPase Na+/K+ transporting alpha 3 polypeptide antibody
    • DYT 12 antibody
    • DYT12 antibody
    • MGC13276 antibody
    • Na(+)/K(+) ATPase alpha(III) subunit antibody
    • Na(+)/K(+) ATPase alpha-3 subunit antibody
    • Na+/K+ ATPase 3 antibody
    • Na+/K+ ATPase alpha 3 subunit antibody
    • RDP antibody
    • Sodium potassium ATPase alpha 3 polypeptide antibody
    • Sodium pump 3 antibody
    • Sodium pump subunit alpha-3 antibody
    • Sodium/potassium transporting ATPase alpha 3 chain antibody
    • Sodium/potassium-transporting ATPase subunit alpha-3 antibody
    see all

Images

  • Anti-alpha 3 Sodium Potassium ATPase antibody (ab176598) at 1/500 dilution + 293 cell lysate

    Predicted band size: 111 kDa

References

ab176598 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176598.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up