Overview

  • Product name

    Anti-Alpha B Crystallin antibody [6D11]
    See all Alpha B Crystallin primary antibodies
  • Description

    Mouse monoclonal [6D11] to Alpha B Crystallin
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IP, IHC-P, Flow Cyt, ICC/IFmore details
  • Species reactivity

    Reacts with: Rat, Human, Monkey
    Predicted to work with: Mouse, Sheep, Rabbit, Cow, Pig, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant full length protein corresponding to Human Alpha B Crystallin aa 1-175. Produced in HEK-293T cells.
    Sequence:

    MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLR PPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEV HGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRK QVSGPERTIPITREEKPAVTAAPKK


    Database link: P02511

  • Positive control

    • WB: COS-7 and PC-12 whole cell lysate. IHC-P: Human thyroid carcinoma and heart tissue. ICC/IF: HT-29 cells. IP: DDK tagged CRYAB overexpression-transfected HEK-293T whole cell lysate. FC: Overexpression plasmid-transfected HEK-293T cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab230722 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 20 kDa.
IP Use at an assay dependent concentration.
IHC-P Use a concentration of 10 µg/ml. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
Flow Cyt 1/100.
ICC/IF 1/50 - 1/100.

Target

Images

  • All lanes : Anti-Alpha B Crystallin antibody [6D11] (ab230722) at 1/500 dilution

    Lane 1 : pCMV6-ENTRY control-transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 2 : pCMV6-ENTRY Alpha B Crystallin-transfected HEK-293T whole cell lysate

    Lysates/proteins at 5 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 20 kDa

  • COS-7 (African green monkey kidney fibroblast-like cell line) cells stained for Alpha B Crystallin (green) using ab230722 at 1/50 dilution in ICC/IF.

  • Formalin-fixed, paraffin-embedded human heart tissue stained for Alpha B Cristallin using ab230722 at 10μg/ml in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded human thyroid carcinoma tissue stained for Alpha B Cristallin using ab230722 at 1/50 dilution in immunohistochemical analysis.

  • HT-29 (human colorectal adenocarcinoma cell line) cells stained for Alpha B Crystallin (green) using ab230722 at 1/50 dilution in ICC/IF.

  • All lanes : Anti-Alpha B Crystallin antibody [6D11] (ab230722) at 1/500 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 3 : HT-29 (human colorectal adenocarcinoma cell line) whole cell lysate
    Lane 4 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 5 : COS-7 (African green monkey kidney fibroblast-like cell line) whole cell lysate
    Lane 6 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 7 : MDCK (canine kidney cell line) whole cell lysate
    Lane 8 : PC-12 (rat adrenal gland pheochromocytoma cell line) whole cell lysate
    Lane 9 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate

    Lysates/proteins at 35 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 20 kDa

  • KAT7 / Hbo1 / MYST2 was immunoprecipitated from 1mg of DDK tagged Alpha B Crystallin overexpression lysate at a 1:5 dilution with HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate with 2μg ab230722..

    Lane 1: IP without ab230722 in DDK tagged Alpha B Crystallin overexpression lysate at a 1:5 dilution with HEK-293T whole cell lysate (negative control)

    Lane 2: ab230722 IP in DDK tagged Alpha B Crystallin overexpression lysate at a 1:5 dilution with HEK-293T whole cell lysate.

  • Flow cytometric analysis of Alpha B Crystallin overexpression plasmid-transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell line labeling Alpha B Crystallin with 230722 at 1/100 dilution (red) compared with an empty vector control plasmid-transfected HEK-293T cells (blue).

References

ab230722 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230722.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up