Overview

  • Product name

    Anti-Alpha B Crystallin antibody
    See all Alpha B Crystallin primary antibodies
  • Description

    Rabbit polyclonal to Alpha B Crystallin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human, Pig
    Predicted to work with: Rat, Sheep, Rabbit, Cow, Cynomolgus monkey, Orangutan
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human Alpha B Crystallin aa 1-175. (Expressed in E.coli).
    Sequence:

    MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLR PPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEV HGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRK QVSGPERTIPITREEKPAVTAAPKK


    Database link: P02511

  • Positive control

    • IHC-P: Human cerebrum, glioma and kidney tissues. WB: Mouse brain, heart and crebrum lysates; Pig brain and cerebrum lysates; Recombinant human Alpha B Crystallin protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab231268 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 20 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

Images

  • Paraffin-embedded human cerebrum tissue stained for Alpha B Crystallin antibody using ab231268 at 10 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human glioma tissue stained for Alpha B Crystallin antibody using ab231268 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human kidney tissue stained for Alpha B Crystallin antibody using ab231268 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Alpha B Crystallin antibody (ab231268) at 2 µg/ml + Recombinant human Alpha B Crystallin protein.

    Predicted band size: 20 kDa

  • All lanes : Anti-Alpha B Crystallin antibody (ab231268) at 3 µg/ml

    Lane 1 : Mouse brain lysate
    Lane 2 : Mouse heart lysate
    Lane 3 : Pig brain lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit antibody at 1/2000 dilution

    Predicted band size: 20 kDa

  • Anti-Alpha B Crystallin antibody (ab231268) at 2 µg/ml + Pig cerebrum lysate.

    Predicted band size: 20 kDa

  • Anti-Alpha B Crystallin antibody (ab231268) at 2 µg/ml + Mouse cerebrum lysate.

    Predicted band size: 20 kDa

  • Anti-Alpha B Crystallin antibody (ab231268) at 2 µg/ml + Mouse heart lysate.

    Predicted band size: 20 kDa

References

ab231268 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231268.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up