Overview

  • Product name

    Anti-alpha COP I/COPA antibody - C-terminal
    See all alpha COP I/COPA primary antibodies
  • Description

    Rabbit polyclonal to alpha COP I/COPA - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
    Unsuitable for: IP
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Sheep, Rabbit, Horse, Chicken, Guinea pig, Cow, Dog, Pig, Xenopus laevis
  • Immunogen

    Synthetic peptide within Human alpha COP I/COPA aa 1174-1224 (C terminal). The exact sequence is proprietary. NP_004362.2.
    Sequence:

    RPIYRGKPVEKCPLSGACYSPEFKGQICRVTTVTEIGKDVIGLRISPLQF R


    Database link: P53621

  • Positive control

    • HeLa, 293T, Jurkat, TCMK1 and NIH 3T3 whole cell lysates.
  • General notes

     This product was previously labelled as alpha COP I

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituent: 99% Tris citrate/phosphate

    pH 7-8
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab192919 was affinity purified using an epitope specific to alpha COP I/COPA immobilized on solid support.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab192919 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/10000. Predicted molecular weight: 138 kDa.
  • Application notes
    Is unsuitable for IP.
  • Target

    • Function

      The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins; the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors.
      Xenin stimulates exocrine pancreatic secretion. It inhibits pentagastrin-stimulated secretion of acid, to induce exocrine pancreatic secretion and to affect small and large intestinal motility. In the gut, xenin interacts with the neurotensin receptor.
    • Tissue specificity

      Uniformly expressed in a wide range of adult and fetal tissues. Xenin is found in gastric, duodenal and jejunal mucosa. Circulates in the blood. Seems to be confined to specific endocrine cells.
    • Sequence similarities

      Contains 6 WD repeats.
    • Developmental stage

      Xenin is released into the circulation after a meal.
    • Cellular localization

      Secreted and Cytoplasm. Golgi apparatus membrane. Cytoplasmic vesicle > COPI-coated vesicle membrane. The coatomer is cytoplasmic or polymerized on the cytoplasmic side of the Golgi, as well as on the vesicles/buds originating from it.
    • Information by UniProt
    • Database links

    • Alternative names

      • Alpha coat protein antibody
      • Alpha COP antibody
      • Alpha COPI antibody
      • Alpha-coat protein antibody
      • Alpha-COP antibody
      • AlphaCOP antibody
      • Coatomer protein complex subunit alpha antibody
      • Coatomer subunit alpha antibody
      • COP A antibody
      • COP I alpha antibody
      • copA antibody
      • COPA_HUMAN antibody
      • COPI alpha antibody
      • FLJ26320 antibody
      • HEP COP antibody
      • HEP-COP antibody
      • HEPCOP antibody
      • Proxenin antibody
      • Xenin antibody
      • Xenopsin-related peptide antibody
      see all

    Images

    • All lanes : Anti-alpha COP I/COPA antibody - C-terminal (ab192919) at 0.1 µg/ml

      Lane 1 : HeLa whole cell lysate
      Lane 2 : 293T whole cell lysate
      Lane 3 : Jurkat whole cell lysate
      Lane 4 : TCMK1 whole cell lysate
      Lane 5 : NIH 3T3 whole cell lysate

      Lysates/proteins at 50 µg per lane.

      Developed using the ECL technique.

      Predicted band size: 138 kDa


      Exposure time: 3 minutes

    References

    ab192919 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    There are currently no Customer reviews or Questions for ab192919.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Sign up