Overview

  • Product name

    Anti-alpha Defensin 5 antibody
    See all alpha Defensin 5 primary antibodies
  • Description

    Rabbit polyclonal to alpha Defensin 5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee
  • Immunogen

    Full length protein corresponding to Human alpha Defensin 5 aa 1-94.
    Sequence:

    MRTIAILAAILLVALQAQAESLQERADEATTQKQSGEDNQDLAISFAGNG LSALRTSGSQARATCYCRTGRCATRESLSGVCEISGRLYRLCCR


    Database link: NP_066290.1

  • Positive control

    • alpha Defensin 5 transfected 293T cell lysate.
  • General notes

     This product was previously labelled as alpha 5 Defensin

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term.
  • Storage buffer

    pH: 7.20
    Constituent: 99% PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab167591 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 10 kDa.

Target

  • Function

    Has antimicrobial activity against Gram-negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane. All DEFA5 peptides exert antimicrobial activities, but their potency is affected by peptide processing.
  • Tissue specificity

    Paneth cells of the small intestine (at protein level).
  • Sequence similarities

    Belongs to the alpha-defensin family.
  • Post-translational
    modifications

    Glycosylated.
  • Cellular localization

    Secreted. Cytoplasmic vesicle > secretory vesicle. Peptides HD5(20-94), HD5(23-94) and HD5(29-94) are found within tissues, HD5(20-94) being the predominant intracellular form. Peptides HD5(56-94) and HD5(63-94) are found in the extracellular milieu, HD5(63-94) being the most abundant form.
  • Information by UniProt
  • Database links

  • Alternative names

    • alpha 5 antibody
    • DEF5 antibody
    • DEF5_HUMAN antibody
    • Defa antibody
    • Defa29 antibody
    • DEFA5 antibody
    • Defcr29 antibody
    • Defcr5 antibody
    • Defensin 5 antibody
    • Defensin alpha 5 antibody
    • Defensin alpha 5 Paneth cell specific antibody
    • Defensin alpha 5 preproprotein antibody
    • Defensin antibody
    • Enteric defensin antibody
    • HD 5 antibody
    • HD5 antibody
    • HD5(20-94) antibody
    • HD5(63-94) antibody
    • MGC129728 antibody
    • RD 5 antibody
    see all

Images

  • All lanes : Anti-alpha Defensin 5 antibody (ab167591) at 1 µg/ml

    Lane 1 : alpha Defensin 5 transfected 293T cell lysate
    Lane 2 : Non-transfected 293T cell lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-rabbit HRP at 1/2500 dilution

    Predicted band size: 10 kDa

References

ab167591 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167591.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up