Overview

  • Product name

  • Description

    Rabbit polyclonal to Alpha SNAP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human Alpha SNAP aa 1-295.
    Sequence:

    MDNSGKEAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIYARAAN MFKMAKNWSAAGNAFCQAAQLHLQLQSKHDAATCFVDAGNAFKKADPQEA INCLMRAIEIYTDMGRFTIAAKHHISIAEIYETELVDIEKAIAHYEQSAD YYKGEESNSSANKCLLKVAGYAALLEQYQKAIDIYEQVGTNAMDSPLLKY SAKDYFFKAALCHFCIDMLNAKLAVQKYEELFPAFSDSRECKLMKKLLEA HEEQNVDSYTESVKEYDSISRLDQWLTTMLLRIKKTIQGDEEDLR


    Database link: P54920

  • Positive control

    • WB: HEK-293T, HeLa and K562 whole cell lysates. IHC-P: Human liver cancer tissue. ICC/IF: MCF7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab237814 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/2000. Predicted molecular weight: 33 kDa.
ICC/IF 1/50 - 1/200.

Target

Images

  • All lanes : Anti-Alpha SNAP antibody (ab237814) at 1/500 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 3 : K562 (human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 33 kDa

  • Paraffin-embedded human liver cancer tissue stained for Alpha SNAP using ab237814 at 1/100 dilution in immunohistochemical analysis.

  • MCF7 (human breast adenocarcinoma cell line) cells stained for Alpha SNAP (green) using ab237814 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488-conjugated goat anti-rabbit IgG (H+L).

References

ab237814 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237814.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up