Overview

  • Product name

  • Description

    Rabbit polyclonal to ALPK2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ALPK2 aa 1341-1429.
    Sequence:

    SSVDPVDEKELSVTDSLSAASETGGKENVNNVSQDQEEKQLKMDHTAFFK KFLTCPKILESSVDPIDEISVIEYTRAGKPEPSETTPQG


    Database link: Q86TB3

  • Positive control

    • IHC-P: Human duodenum tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224130 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Kinases that recognize phosphorylation sites in which the surrounding peptides have an alpha-helical conformation.
  • Sequence similarities

    Belongs to the protein kinase superfamily. Alpha-type protein kinase family. ALPK subfamily.
    Contains 1 alpha-type protein kinase domain.
    Contains 2 Ig-like (immunoglobulin-like) domains.
  • Information by UniProt
  • Database links

  • Alternative names

    • Alpha-protein kinase 2 antibody
    • ALPK2 antibody
    • ALPK2_HUMAN antibody
    • FLJ34875 antibody
    • FLJ43253 antibody
    • Gm549 antibody
    • HAK antibody
    • Heart alpha-protein kinase antibody
    • RGD1564431 antibody
    see all

Images

  • Paraffin-embedded human duodenum tissue stained for ALPK2 using ab224130 at 1/50 dilution in immunohistochemical analysis.

References

ab224130 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224130.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up