Overview

  • Product name

  • Description

    Rabbit polyclonal to ALR/HPO
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant full length protein corresponding to Human ALR/HPO aa 1-125. (BC028348).
    Sequence:

    MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMA QFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRK LGKPDFDCSKVDERWRDGWKDGSCD


    Database link: P55789-2

  • Positive control

    • Mouse liver lysate; Human colon cancer tissue.
  • General notes

     This product was previously labelled as ALR

     

Properties

  • Form

    Lyophilised:Reconstitute in 200ul sterile H2O.
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 98% PBS, 1% BSA
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab205282 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
WB 1/200 - 1/1000. Detects a band of approximately 23 kDa (predicted molecular weight: 15, 23 kDa).

Target

  • Function

    Isoform 1: FAD-dependent sulfhydryl oxidase. Within the mitochondrial intermembrane space, participates in a chain of disulfide exchange reactions with MIA40, that generate disulfide bonds in a number of resident proteins with twin Cx3C and Cx9C motifs.
    Isoform 2: May act as an autocrine hepatotrophic growth factor promoting liver regeneration.
  • Tissue specificity

    Ubiquitously expressed. Highest expression in the testis and liver and low expression in the muscle.
  • Involvement in disease

    Defects in GFER are a cause of mitochondrial progressive myopathy with congenital cataract hearing loss and developmental delay (MPMCHD) [MIM:613076]; also called combined mitochondrial complex deficiency.
  • Sequence similarities

    Contains 1 ERV/ALR sulfhydryl oxidase domain.
  • Cellular localization

    Mitochondrion intermembrane space and Cytoplasm. Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • ALR_HUMAN antibody
    • Augmenter of liver regeneration antibody
    • ERV1 antibody
    • ERV1 homolog antibody
    • Erv1 like growth factor antibody
    • FAD-linked sulfhydryl oxidase ALR antibody
    • GFER antibody
    • Growth factor augmenter of liver regeneration antibody
    • Growth factor erv1 like antibody
    • Hepatic regenerative stimulation substance antibody
    • Hepatopoietin antibody
    • Hepatopoietin protein antibody
    • hERV1 antibody
    • HPO antibody
    • HPO1 antibody
    • HPO2 antibody
    • HSS antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human colon cancer tissue labeling ALR/HPO with ab205282 at 1/100 dilution.

  • Anti-ALR/HPO antibody (ab205282) at 1/500 dilution + Mouse liver lysate

    Predicted band size: 15, 23 kDa
    Observed band size: 23 kDa
    why is the actual band size different from the predicted?

References

ab205282 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab205282.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up