Overview

  • Product name

  • Description

    Rabbit polyclonal to Alx1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human Alx1 aa 10-304.
    Sequence:

    LKSPPSKNSDFYMGAGGPLEHVMETLDNESFYSKASAGKCVQAFGPLPRA EHHVRLERTSPCQDSSVNYGITKVEGQPLHTELNRAMDNCNSLRMSPVKG MQEKGELDELGDKCDSNVSSSKKRRHRTTFTSLQLEELEKVFQKTHYPDV YVREQLALRTELTEARVQVWFQNRRAKWRKRERYGQIQQAKSHFAATYDI SVLPRTDSYPQIQNNLWAGNASGGSVVTSCMLPRDTSSCMTPYSHSPRTD SSYTGFSNHQNQFSHVPLNNFFTDSLLTGATNGHAFETKPEFERR


    Database link: Q15699

  • Positive control

    • WB: HeLa, MCF7 and HepG2 whole cell lysates. IHC-P: Human brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab234726 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Detects a band of approximately 36 kDa (predicted molecular weight: 37 kDa).

Target

  • Function

    Transcriptional activator that acts at a palindromic recognition sequence to enhance the activity of the SV40 and TK promoters. Functions as a repressor with the prolactin promoter in vivo. May play a role in chondrocyte differentiation and may also influence cervix development.
  • Tissue specificity

    Cartilage and cervix tissue.
  • Involvement in disease

    Defects in ALX1 are the cause of frontonasal dysplasia type 3 (FND3) [MIM:613456]. The term frontonasal dysplasia describes an array of abnormalities affecting the eyes, forehead and nose and linked to midfacial dysraphia. The clinical picture is highly variable. Major findings include true ocular hypertelorism; broadening of the nasal root; median facial cleft affecting the nose and/or upper lip and palate; unilateral or bilateral clefting of the alae nasi; lack of formation of the nasal tip; anterior cranium bifidum occultum; a V-shaped or widow's peak frontal hairline.
  • Sequence similarities

    Belongs to the paired homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Post-translational
    modifications

    Acetylated at Lys-131 by EP300, leading to increased interaction with EP300 and enhances transcriptional activation activity.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • ALX homeobox 1 antibody
    • ALX homeobox protein 1 antibody
    • ALX1 antibody
    • ALX1_HUMAN antibody
    • CART 1 antibody
    • CART-1 antibody
    • CART1 antibody
    • Cartilage homeoprotein 1 antibody
    • Cartilage paired class homeoprotein 1 antibody
    • FND3 antibody
    see all

Images

  • All lanes : Anti-Alx1 antibody (ab234726) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
    Lane 3 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 37 kDa
    Observed band size: 36 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human brain tissue stained for Alx1 with ab234726 at 1/100 dilution in immunohistochemical analysis.

References

ab234726 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234726.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up