Overview

  • Product name

  • Description

    Rabbit polyclonal to ALX4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ALX4 aa 32-143.
    Sequence:

    SPFRAFPGGDKFGTTFLSAAAKAQGFGDAKSRARYGAGQQDLATPLESGA GARGSFNKFQPQPSTPQPQPSPQPQPQQQQPQPQPPAQPHLYLQRGACKT PPDGSLKLQEGS


    Database link: Q9H161

  • Positive control

    • SiHa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab219832 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Transcription factor involved in skull and limb development. Plays an essential role in craniofacial development, skin and hair follicle development.
  • Tissue specificity

    Expression is likely to be restricted to bone. Found in parietal bone.
  • Involvement in disease

    Defects in ALX4 are the cause of parietal foramina 2 (PFM2) [MIM:609597]; also known as foramina parietalia permagna (FPP). PFM2 is an autosomal dominant disease characterized by oval defects of the parietal bones caused by deficient ossification around the parietal notch, which is normally obliterated during the fifth fetal month. PFM2 is also a clinical feature of Potocki-Shaffer syndrome.
    Defects in ALX4 are the cause of frontonasal dysplasia type 2 (FND2) [MIM:613451]. The term frontonasal dysplasia describes an array of abnormalities affecting the eyes, forehead and nose and linked to midfacial dysraphia. The clinical picture is highly variable. Major findings include true ocular hypertelorism; broadening of the nasal root; median facial cleft affecting the nose and/or upper lip and palate; unilateral or bilateral clefting of the alae nasi; lack of formation of the nasal tip; anterior cranium bifidum occultum; a V-shaped or widow's peak frontal hairline.
    Involved in Potocki-Shaffer syndrome (PSS) [MIM:601224]. PSS is a contiguous gene syndrome caused by deletion of the 11p11.2 region.
  • Sequence similarities

    Belongs to the paired homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Alx4 antibody
    • ALX4_HUMAN antibody
    • Aristaless like homeobox 4 antibody
    • CRS5 antibody
    • FND2 antibody
    • FPP antibody
    • homeobox protein aristaless like 4 antibody
    • Homeobox protein aristaless-like 4 antibody
    • homeodomain transcription factor ALX4 antibody
    • KIAA1788 antibody
    • PFM1 antibody
    • PFM2 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized SiHa cells labeling ALX4 with ab219832 at 4 μg/ml (green).

References

ab219832 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
ChIP
Sample
Human Cell lysate - whole cell (A673 Ewing sarcoma cell line)
Negative control
IgG isotype antibody in A673
Specification
A673 Ewing sarcoma cell line
Detection step
Other
Type
Cross-linking (X-ChIP)
Duration of cross-linking step: 10 minute(s) and 0 second(s)
Specification of the cross-linking agent: methanol-free formaldehyde
Positive control
ALX4 antibody in A673

Abcam user community

Verified customer

Submitted Aug 16 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up