Anti-AMACO antibody (ab177103)
Key features and details
- Rabbit polyclonal to AMACO
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-AMACO antibody -
Description
Rabbit polyclonal to AMACO -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human AMACO aa 201-373. BC128588
Sequence:RGQHVLLAEQVEDATNGLFSTLSSSAICSSATPDCRVEAHPCEHRTLEMV REFAGNAPCWRGSRRTLAVLAAHCPFYSWKRVFLTHPATCYRTTCPGPCD SQPCQNGGTCVPEGLDGYQCLCPLAFGGEANCALKLSLECRVDLLFLLDS SAGTTLDGFLRAKVFVKRFVRAV
Database link: Q5GFL6 -
Positive control
- HL60, A549, HeLa and HepG2 lysates. Human colon carcinoma tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Lyophilized:Reconstitute with 200ul distilled sterile water. Please note that if you receive this product in liquid form it has already been reconstituted as described and no further reconstitution is necessary. -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 98% PBS, 1% BSA -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab177103 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/200 - 1/1000. Predicted molecular weight: 82 kDa.
|
|
IHC-P |
1/100 - 1/500.
|
Notes |
---|
WB
1/200 - 1/1000. Predicted molecular weight: 82 kDa. |
IHC-P
1/100 - 1/500. |
Target
-
Tissue specificity
Expression is generally absent in normal colon and other normal body tissues, but it is induced an average of 78-fold in Stage II, III, and IV colon cancers, as well as in colon adenomas and colon cancer cell lines. -
Sequence similarities
Contains 2 EGF-like domains.
Contains 3 VWFA domains. -
Post-translational
modificationsA 55 kDa form is produced by proteolytic cleavage. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 340706 Human
- SwissProt: Q5GFL6 Human
- Unigene: 197741 Human
-
Alternative names
- A domain-containing protein similar to matrilin and collagen antibody
- AMACO antibody
- CCSP-2 antibody
see all
Images
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab177103 has not yet been referenced specifically in any publications.