Overview

  • Product name
  • Description
    Rabbit polyclonal to AMACR
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human AMACR aa 1-382.
    Sequence:

    MALQGISVVELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGK RSLVLDLKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENP RLIYARLSGFGQSGSFCRLAGHDINYLALSGVLSKIGRSGENPYAPLNLL ADFAGGGLMCALGIIMALFDRTRTGKGQVIDANMVEGTAYLSSFLWKTQK LSLWEAPRGQNMLDGGAPFYTTYRTADGEFMAVGAIEPQFYELLIKGLGL KSDELPNQMSMDDWPEMKKKFADVFAEKTKAEWCQIFDGTDACVTPVLTF EEVVHHDHNKERGSFITSEEQDVSPRPAPLLLNTPAIPSFKRDPFIGEHT EEILEEFGFSREEIYQLNSDKIIESNKVKASL


    Database link: Q9UHK6

  • Positive control
    • PC3, SW480, HeLa, ES-2 and liver cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab175280 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 42 kDa.
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

Target

  • Function
    Racemization of 2-methyl-branched fatty acid CoA esters. Responsible for the conversion of pristanoyl-CoA and C27-bile acyl-CoAs to their (S)-stereoisomers.
  • Pathway
    Lipid metabolism; bile acid biosynthesis.
    Lipid metabolism; fatty acid metabolism.
  • Involvement in disease
    Defects in AMACR are the cause of alpha-methylacyl-CoA racemase deficiency (AMACRD) [MIM:614307]. AMACRD results in elevated plasma concentrations of pristanic acid C27-bile-acid intermediates. It can be associated with polyneuropathy, retinitis pigmentosa, epilepsy.
    Defects in AMACR are the cause of congenital bile acid synthesis defect type 4 (CBAS4) [MIM:214950]; also known as cholestasis, intrahepatic, with defective conversion of trihydroxycoprostanic acid to cholic acid or trihydroxycoprostanic acid in bile. Clinical features include neonatal jaundice, intrahepatic cholestasis, bile duct deficiency and absence of cholic acid from bile.
  • Sequence similarities
    Belongs to the CaiB/BaiF CoA-transferase family.
  • Cellular localization
    Peroxisome. Mitochondrion.
  • Information by UniProt
  • Database links
  • Alternative names
    • 2 arylpropionyl CoA epimerase antibody
    • 2 methylacyl CoA racemase antibody
    • 2-methylacyl-CoA racemase antibody
    • Alpha methylacyl CoA racemase antibody
    • Alpha methylacyl Coenzyme A racemase antibody
    • Alpha methylacyl-CoA racemase deficiency, included antibody
    • Alpha-methylacyl-CoA racemase antibody
    • Amacr antibody
    • AMACR deficiency, included antibody
    • AMACR_HUMAN antibody
    • CBAS4 antibody
    • Da1-8 antibody
    • EC 5.1.99.4 antibody
    • Macr1 antibody
    • Methylacyl CoA racemase alpha antibody
    • RACE antibody
    • RM antibody
    see all

Images

  • All lanes : Anti-AMACR antibody (ab175280) at 1/500 dilution

    Lane 1 : PC3 cell lysate
    Lane 2 : SW480 cell lysate
    Lane 3 : HeLa cell lysate
    Lane 4 : ES-2 cell lysate
    Lane 5 : liver cell lysate

    Predicted band size: 42 kDa

References

ab175280 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175280.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up