Anti-AMH antibody [5/6] (ab24542)
Key features and details
- Mouse monoclonal [5/6] to AMH
- Suitable for: IHC-P
- Reacts with: Mouse
- Isotype: IgG1
Overview
-
Product name
Anti-AMH antibody [5/6]
See all AMH primary antibodies -
Description
Mouse monoclonal [5/6] to AMH -
Host species
Mouse -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Mouse
Predicted to work with: Rat, Cow, Pig -
Immunogen
Synthetic peptide:
VPTAYAGKLLISLSEERISAHHVPNMVATEC
, corresponding to C terminal amino acids 527-557 of Human AMH. -
Positive control
- Mouse ovary tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituent: Tissue culture supernatant -
Concentration information loading...
-
Purity
Tissue culture supernatant -
Clonality
Monoclonal -
Clone number
5/6 -
Myeloma
Sp2/0 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab24542 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P |
1/20 - 1/40. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
Notes |
---|
IHC-P
1/20 - 1/40. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Relevance
Anti mullerian hormone (AMH) is a member of the TGF beta superfamily. It is secreted as a homodimeric 140kD disulphide linked precursor that is cleaved to release the mature 30kD homodimer. Originally classified as a foetal testicular hormone that inhibits Mullerian duct development, AMH is expressed post natally by immature Sertoli cells, and to a lesser degree by granulosa cells. AMH plays a role in testicular differentiation and in the regulation of ovarian follicle growth. -
Cellular localization
Secreted -
Database links
- Entrez Gene: 280718 Cow
- Entrez Gene: 11705 Mouse
- Entrez Gene: 25378 Rat
- SwissProt: P27106 Mouse
- SwissProt: P49000 Rat
-
Alternative names
- Anti muellerian hormone antibody
- MIF antibody
- MIS antibody
see all
Images
Datasheets and documents
-
SDS download
-
Datasheet download
References (12)
ab24542 has been referenced in 12 publications.
- Agopiantz M et al. Fertility in McCune Albright syndrome female: A case study focusing on AMH as a marker of ovarian dysfunction and a literature review. J Gynecol Obstet Hum Reprod 50:102171 (2021). PubMed: 34048958
- Pourjafari F et al. Evaluation of expression and serum concentration of anti-Mullerian hormone as a follicle growth marker following consumption of fennel and flaxseed extract in first-generation mice pups. BMC Complement Med Ther 21:90 (2021). PubMed: 33711998
- Maistrelli C et al. Precocious puberty in male wild boars: a possible explanation for the dramatic population increase in Germany and Europe. PeerJ 9:e11798 (2021). PubMed: 34322327
- Gao L et al. Therapeutic Effects of Modified Gengnianchun Formula on Stress-Induced Diminished Ovarian Reserve Based on Experimental Approaches and Network Pharmacology. Drug Des Devel Ther 14:4975-4992 (2020). PubMed: 33239863
- Hilbold E et al. Loss of Cx43 in Murine Sertoli Cells Leads to Altered Prepubertal Sertoli Cell Maturation and Impairment of the Mitosis-Meiosis Switch. Cells 9:N/A (2020). PubMed: 32164318