Overview

  • Product name

  • Description

    Rabbit polyclonal to AMH
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    A 16 amino acid peptide from near the C terminal residues of Human AMH protein (NM_000479)

  • Positive control

    • Human fetal testis lysates. IF: Lovo cell line

Properties

Applications

Our Abpromise guarantee covers the use of ab84415 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/200 - 1/1000. Detects a band of approximately 60 kDa (predicted molecular weight: 60 kDa).
ICC/IF 1/200.

Target

  • Relevance

    Anti mullerian hormone (AMH) is a member of the TGF beta superfamily. It is secreted as a homodimeric 140kD disulphide linked precursor that is cleaved to release the mature 30kD homodimer. Originally classified as a foetal testicular hormone that inhibits Mullerian duct development, AMH is expressed post natally by immature Sertoli cells, and to a lesser degree by granulosa cells. AMH plays a role in testicular differentiation and in the regulation of ovarian follicle growth.
  • Cellular localization

    Secreted
  • Database links

  • Alternative names

    • Anti muellerian hormone antibody
    • MIF antibody
    • MIS antibody
    • Muellerian inhibiting factor antibody
    • Mullerian inhibiting substance antibody
    see all

Images

  • Anti-AMH antibody (ab84415) at 1/1000 dilution + human fetal testis lysates

    Predicted band size: 60 kDa
    Observed band size: 60 kDa

  • ICC/IF image of ab84415 stained Lovo cells. The cells were 4% formaldehyde fixed (10 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab84415, 1µg/ml) overnight at +4°C. The secondary antibody (green) was ab96899, DyLight® 488 goat anti-rabbit IgG (H+L) used at a 1/250 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

References

ab84415 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-4 of 4 Abreviews or Q&A

Answer

Thank you for contacting us.

We generally recommend an expiry date of 10 years for antibodies stored at -80C. 50% Glycerol is recommended when abs stored at -80C.

We would not be able to guarantee the antibody after buffer exchange. Theatrically, it should be fine however we will not be able ot confirm it due to lack of tested data.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Use our products? Submit an Abreview. Earn rewards!
https://www.abcam.com/abreviews

Read More

Answer

Thank you for contacting us. The concentration of the current lot of this Protein A purified anti-AMH antibody is 10mg/ml. I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Read More

Answer

Thank you for contacting us.  I have confirmed with the labs that made ab84415 and ab90241 that they have no information about anyone having ever tested these antibodies in paired applications.  I am sorry I could not provide any specific recommendations, please let me know if you have any additional questions or concerns. 

Read More

Question
Answer

Thank you for your enquiry. ab84415 - The immunogen is a 15 amino acid peptide within the 50 amino acids of the C terminus of human AMH/MIS: LKMQVRGAALARPPCCVPTAYAGKLLISLSEERISAHHVPNMVATECGCR The exact sequence is considered to be proprietary information. The epitopes have not been mapped but they will be within that 50 aa range. ab90241 - The immunogen is a recombinant fragment of human AMH/MIS, within the sequence of amino acids 455 - 560, protein access number # NP_000470. The epitope has not, to our knowledge, been mapped.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up