Overview

  • Product name

    Anti-AMH antibody [MM0475-7H26]
    See all AMH primary antibodies
  • Description

    Mouse monoclonal [MM0475-7H26] to AMH
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    C-terminal active form (Human) AMH

Properties

Applications

Our Abpromise guarantee covers the use of ab90241 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 60 kDa.

Target

  • Relevance

    Anti mullerian hormone (AMH) is a member of the TGF beta superfamily. It is secreted as a homodimeric 140kD disulphide linked precursor that is cleaved to release the mature 30kD homodimer. Originally classified as a foetal testicular hormone that inhibits Mullerian duct development, AMH is expressed post natally by immature Sertoli cells, and to a lesser degree by granulosa cells. AMH plays a role in testicular differentiation and in the regulation of ovarian follicle growth.
  • Cellular localization

    Secreted
  • Database links

  • Alternative names

    • Anti muellerian hormone antibody
    • MIF antibody
    • MIS antibody
    • Muellerian inhibiting factor antibody
    • Mullerian inhibiting substance antibody
    see all

References

ab90241 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Answer

Thank you for contacting us.  I have confirmed with the labs that made ab84415 and ab90241 that they have no information about anyone having ever tested these antibodies in paired applications.  I am sorry I could not provide any specific recommendations, please let me know if you have any additional questions or concerns. 

Read More

Question
Answer

Thank you for your enquiry. ab84415 - The immunogen is a 15 amino acid peptide within the 50 amino acids of the C terminus of human AMH/MIS: LKMQVRGAALARPPCCVPTAYAGKLLISLSEERISAHHVPNMVATECGCR The exact sequence is considered to be proprietary information. The epitopes have not been mapped but they will be within that 50 aa range. ab90241 - The immunogen is a recombinant fragment of human AMH/MIS, amino acids 455 - 560, protein accession number # NP_000470. The epitope has not, to our knowledge, been mapped.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up