Overview

  • Product name

  • Description

    Rabbit polyclonal to AMHR2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit
  • Immunogen

    Recombinant fragment corresponding to Human AMHR2 aa 207-440. BC126316.
    Sequence:

    QVIREGGHAVVWAGQLQGKLVAIKAFPPRSVAQFQAERALYELPGLQHDH IVRFITASRGGPGRLLSGPLLVLELHPKGSLCHYLTQYTSDWGSSLRMAL SLAQGLAFLHEERWQNGQYKPGIAHRDLSSQNVLIREDGSCAIGDLGLAL VLPGLTQPPAWTPTQPQGPAAIMEAGTQRYMAPELLDKTLDLQDWGMALR RADIYSLALLLWEILSRCPDLRPDSSPPPFQLAY


    Database link: Q16671

  • Positive control

    • HEK293, HEK293T and MCF7 cell lysates. Human fetal testis tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab197148 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2000. Predicted molecular weight: 63 kDa.
IHC-P 1/100 - 1/500.

Target

  • Function

    On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for anti-Muellerian hormone.
  • Involvement in disease

    Defects in AMHR2 are the cause of persistent Muellerian duct syndrome type 2 (PMDS2) [MIM:261550]. PMDS2 is a form of male pseudohermaphroditism characterized by a failure of Muellerian duct regression in otherwise normal males.
  • Sequence similarities

    Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.
    Contains 1 protein kinase domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • AMH type II receptor antibody
    • AMHR antibody
    • AMHR2 antibody
    • AMHR2_HUMAN antibody
    • Anti Mullerian hormone receptor, type II antibody
    • Anti-Muellerian hormone type II receptor antibody
    • Anti-Muellerian hormone type-2 receptor antibody
    • MGC141312 antibody
    • MIS type II receptor antibody
    • MISR2 antibody
    • MISRII antibody
    • MRII antibody
    • Muellerian hormone type 2 receptor antibody
    • Muellerian hormone type II receptor antibody
    • Muellerian inhibiting substance type II receptor antibody
    • Mullerian hormone receptor type II antibody
    • Mullerian inhibiting substance type II receptor antibody
    see all

Images

  • All lanes : Anti-AMHR2 antibody (ab197148) at 1/1000 dilution

    Lane 1 : HEK293 cell lysate
    Lane 2 : 293T cell lysate
    Lane 3 : MCF7 cell lysate

    Predicted band size: 63 kDa

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human fetal testis tissue labeling AMHR2 with ab197148 at 1/100 dilution.

References

ab197148 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab197148.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up