Overview

  • Product name

  • Description

    Rabbit polyclonal to AMN
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human AMN aa 20-169.
    Sequence:

    VSKLWVPNTDFDVAANWSQNRTPCAGGAVEFPADKMVSVLVQEGHAVSDM LLPLDGELVLASGAGFGVSDVGSHLDCGAGEPAVFRDSDRFSWHDPHLWR SGDEAPGLFFVDAERVPCRHDDVFFPPSASFRVGLGPGASPVRVRSISAL


    Database link: Q9BXJ7

  • Positive control

    • IHC-P: Human small intestine tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224213 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Necessary for efficient absorption of vitamin B12. May direct the production of trunk mesoderm during development by modulating a bone morphogenetic protein (BMP) signaling pathway in the underlying visceral endoderm.
  • Tissue specificity

    Long isoforms are highly expressed in small intestine, colon and kidney (renal proximal tubule epithelial cells). Shorter isoforms are detected at lower levels in testis, thymus and peripheral blood leukocytes.
  • Involvement in disease

    Defects in AMN are a cause of recessive hereditary megaloblastic anemia 1 (RH-MGA1) [MIM:261100]; also known as MGA1 Norwegian type or Imerslund-Grasbeck syndrome (I-GS). RH-MGA1 is due to selective malabsorption of vitamin B12. Defects in vitamin B12 absorption lead to impaired function of thymidine synthase. As a consequence DNA synthesis is interrupted. Rapidly dividing cells involved in erythropoiesis are particularly affected.
  • Sequence similarities

    Contains 1 VWFC domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 5033428N14Rik antibody
    • amn antibody
    • Amnion associated transmembrane protein antibody
    • Amnionless antibody
    • Amnionless homolog antibody
    • AMNLS_HUMAN antibody
    • AV002116 antibody
    • PRO1028 antibody
    • Protein amnionless antibody
    • Type I transmembrane protein antibody
    • UNQ513/PRO1028 antibody
    • Visceral endoderm specific type 1 transmembrane protein antibody
    see all

Images

  • Paraffin-embedded human small intestine tissue stained for AMN using ab224213 at 1/200 dilution in immunohistochemical analysis.

References

ab224213 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224213.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up