Overview

  • Product name

  • Description

    Rabbit polyclonal to Amphiphysin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human Amphiphysin aa 621-694.
    Sequence:

    PGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQDAGWLVGVKE SDWLQYRDLATYKGLFPENFTRRL


    Database link: P49418

  • Positive control

    • IHC-P: Human cerebral cortex and colon tissue. WB: RT4 cell lysate. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab244375 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 0.4 µg/ml.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    May participate in mechanisms of regulated exocytosis in synapses and certain endocrine cell types. May control the properties of the membrane associated cytoskeleton.
  • Tissue specificity

    Neurons, certain endocrine cell types and spermatocytes.
  • Sequence similarities

    Contains 1 BAR domain.
    Contains 1 SH3 domain.
  • Cellular localization

    Cytoplasmic vesicle > secretory vesicle > synaptic vesicle membrane. Cytoplasm > cytoskeleton.
  • Information by UniProt
  • Database links

  • Alternative names

    • Amp antibody
    • AMPH 1 antibody
    • AMPH antibody
    • AMPH_HUMAN antibody
    • AMPH1 antibody
    • Amphiphysin (Stiff-Man syndrome with breast cancer 128kD autoantigen) antibody
    • Amphiphysin (Stiff-Man syndrome with breast cancer 128kDa autoantigen) antibody
    • Amphiphysin antibody
    • Amphiphysin I antibody
    • CG8604 antibody
    • Damp antibody
    • dAmph antibody
    • Dmel\CG8604 antibody
    • HGNC:471 antibody
    • MGC49429 antibody
    • Stiff man syndrome with breast cancer 128kD autoantigen antibody
    • Stiff man syndrome with breast cancer 128kDa autoantigen antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for Amphiphysin (green) using ab244375 at 4 µg/ml in ICC/IF.

  • Anti-Amphiphysin antibody (ab244375) at 0.4 µg/ml + RT4 (Human urinary bladder cancer cell line) cell lysate
  • Paraffin-embedded human cerebral cortex tissue stained for Amphiphysin using ab244375 at 1/1000 dilution in immunohistochemical analysis.
  • Paraffin-embedded human colon tissue stained for Amphiphysin using ab244375 at 1/1000 dilution in immunohistochemical analysis.
  • Paraffin-embedded human kidney tissue stained for Amphiphysin using ab244375 at 1/1000 dilution in immunohistochemical analysis.
  • Paraffin-embedded human tonsil tissue stained for Amphiphysin using ab244375 at 1/1000 dilution in immunohistochemical analysis.

    Low expression as expected.

References

ab244375 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab244375.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up