Anti-Amphiregulin antibody (ab224350)
Key features and details
- Rabbit polyclonal to Amphiregulin
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Amphiregulin antibody
See all Amphiregulin primary antibodies -
Description
Rabbit polyclonal to Amphiregulin -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human Amphiregulin aa 40-181.
Sequence:FSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDN EPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRN RKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERC
Database link: P15514 -
Positive control
- IHC-P: Human placenta tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab224350 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Bifunctional growth-modulating glycoprotein. Inhibits growth of several human carcinoma cells in culture and stimulates proliferation of human fibroblasts and certain other tumor cells. -
Sequence similarities
Belongs to the amphiregulin family.
Contains 1 EGF-like domain. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 374 Human
- Entrez Gene: 727738 Human
- Omim: 104640 Human
- SwissProt: P15514 Human
- Unigene: 270833 Human
- Unigene: 645475 Human
-
Alternative names
- A REG antibody
- Amphiregulin antibody
- Amphiregulin B antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Amphiregulin antibody (ab224350)
Paraffin-embedded human liver stained for Amphiregulin using ab224350 at 1/500 dilution in immunohistochemical analysis. Shows no positivity in hepatocytes cells.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Amphiregulin antibody (ab224350)
Paraffin-embedded human placenta stained for Amphiregulin using ab224350 at 1/500 dilution in immunohistochemical analysis. Shows moderate cytoplasmic and membranous positivity in trophoblastic cells.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Amphiregulin antibody (ab224350)
Paraffin-embedded human testis stained for Amphiregulin using ab224350 at 1/500 dilution in immunohistochemical analysis. Shows weak cytoplasmic and membranous positivity in cells in seminiferous ducts.
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Amphiregulin antibody (ab224350)
Paraffin-embedded human Fallopian tube stained for Amphiregulin using ab224350 at 1/500 dilution in immunohistochemical analysis. Shows moderate cytoplasmic and membranous positivity in glandular cells.
Datasheets and documents
References (1)
ab224350 has been referenced in 1 publication.
- Karagianni AE et al. Transcriptional Response of Ovine Lung to Infection with Jaagsiekte Sheep Retrovirus. J Virol 93:N/A (2019). PubMed: 31434729