Overview

  • Product name

    Anti-Amphiregulin antibody - BSA and Azide free
    See all Amphiregulin primary antibodies
  • Description

    Sheep polyclonal to Amphiregulin - BSA and Azide free
  • Host species

    Sheep
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Amphiregulin aa 107-184. E. coli derived.
    Sequence:

    VVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIH GECKYIEHLEAVTCKCQQEYFGERCGEK


    Database link: P15514

  • Positive control

    • Human liver tissue lysate

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Constituent: 100% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    The IgG fraction of culture supernatant was purified by antigen affinity chromatography and 0.2 µM filtered.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab213698 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/2000. Predicted molecular weight: 28 kDa.

Target

  • Function

    Bifunctional growth-modulating glycoprotein. Inhibits growth of several human carcinoma cells in culture and stimulates proliferation of human fibroblasts and certain other tumor cells.
  • Sequence similarities

    Belongs to the amphiregulin family.
    Contains 1 EGF-like domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • A REG antibody
    • Amphiregulin antibody
    • Amphiregulin B antibody
    • AR antibody
    • AREG antibody
    • AREG_HUMAN antibody
    • AREGB antibody
    • Colorectum cell derived growth factor antibody
    • Colorectum cell-derived growth factor antibody
    • CRDGF antibody
    • MGC13647 antibody
    • Schwannoma derived growth factor antibody
    • SDGF antibody
    see all

Images

  • Anti-Amphiregulin antibody - BSA and Azide free (ab213698) at 1/1000 dilution + Human liver tissue lysate

    Predicted band size: 28 kDa

References

ab213698 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab213698.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up