Overview

  • Product name

  • Description

    Rabbit polyclonal to AMPK beta 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat
    Predicted to work with: Human
  • Immunogen

    Synthetic peptide within Human AMPK beta 1 aa 238-270 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    HLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI


    Database link: Q9Y478

  • Positive control

    • Rat brain tissue; mouse colon carcinoma tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab218040 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function

    Non-catalytic subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Beta non-catalytic subunit acts as a scaffold on which the AMPK complex assembles, via its C-terminus that bridges alpha (PRKAA1 or PRKAA2) and gamma subunits (PRKAG1, PRKAG2 or PRKAG3).
  • Sequence similarities

    Belongs to the 5'-AMP-activated protein kinase beta subunit family.
  • Domain

    The glycogen-binding domain may target AMPK to glycogen so that other factors like glycogen-bound debranching enzyme or protein phosphatases can directly affect AMPK activity.
  • Post-translational
    modifications

    Phosphorylated when associated with the catalytic subunit (PRKAA1 or PRKAA2). Phosphorylated by ULK1; leading to negatively regulate AMPK activity and suggesting the existence of a regulatory feedback loop between ULK1 and AMPK.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1300015D22Rik antibody
    • 5''-AMP-activated protein kinase subunit beta-1 antibody
    • 5'-AMP-activated protein kinase beta-1 subunit antibody
    • AAKB1_HUMAN antibody
    • AMP-activated protein kinase beta subunit antibody
    • AMP-ACTIVATED PROTEIN KINASE, NONCATALYTIC, BETA-1 antibody
    • AMP-activated, noncatalytic, beta-1 antibody
    • AMPK antibody
    • AMPK beta 1 chain antibody
    • AMPK subunit beta-1 antibody
    • AMPK-BETA-1 antibody
    • AMPKb antibody
    • AU021155 antibody
    • E430008F22 antibody
    • HAMPKb antibody
    • MGC17785 antibody
    • PRKAB1 antibody
    • Protein kinase AMP activated non catalytic subunit beta 1 antibody
    • protein kinase, AMP-activated, beta 1 non-catalytic subunit antibody
    • protein kinase, AMP-activated, noncatalytic, beta-1 antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling AMPK beta 1 with ab218040 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse colon carcinoma tissue labeling AMPK beta 1 with ab218040 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab218040 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab218040.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up