Overview

  • Product name

  • Description

    Rabbit polyclonal to AMPS
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Recombinant fragment corresponding to Human AMPS aa 1-310.
    Sequence:

    MAAGGDHGSPDSYRSPLASRYASPEMCFVFSDRYKFRTWRQLWLWLAEAE QTLGLPITDEQIQEMKSNLENIDFKMAAEEEKRLRHDVMAHVHTFGHCCP KAAGIIHLGATSCYVGDNTDLIILRNALDLLLPKLARVISRLADFAKERA SLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDDLRFRGVKG TTGTQASFLQLFEGDDHKVEQLDKMVTEKAGFKRAFIITGQTYTRKVDIE VLSVLASLGASVHKICTDIRLLANLKEMEEPFEKQQIGSSAMPYKRNPMR SERCCSLARH


    Database link: P30566

  • Positive control

    • WB: Hela whole cell lysate. Mouse heart tissue lysate. IHC-P: Human lung tissue.
  • General notes

    Previously labelled as Adenylosuccinate Lyase. 

Properties

Applications

Our Abpromise guarantee covers the use of ab236582 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 55 kDa.
IHC-P 1/20 - 1/200.

Target

  • Tissue specificity

    Ubiquitously expressed. Both isoforms are produced by all tissues. Isoform 2 is 10-fold less abundant than isoform 1.
  • Pathway

    Purine metabolism; AMP biosynthesis via de novo pathway; AMP from IMP: step 2/2.
    Purine metabolism; IMP biosynthesis via de novo pathway; 5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamide from 5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxylate: step 2/2.
  • Involvement in disease

    Defects in ADSL are the cause of adenylosuccinase deficiency (ADSL deficiency) [MIM:103050]. ADSL deficiency is an autosomal recessive disorder characterized by the accumulation in the body fluids of succinylaminoimidazole-carboxamide riboside (SAICA-riboside) and succinyladenosine (S-Ado). Most children display marked psychomotor delay, often accompanied by epilepsy or autistic features, or both, although some patients may be less profoundly retarded. Occasionally, growth retardation and muscular wasting are also present.
  • Sequence similarities

    Belongs to the lyase 1 family. Adenylosuccinate lyase subfamily.
  • Information by UniProt
  • Database links

  • Alternative names

    • Adenylosuccinase antibody
    • Adenylosuccinate lyase antibody
    • ADSL antibody
    • AMPS antibody
    • ASase antibody
    • ASL antibody
    • OTTHUMP00000199172 antibody
    • OTTHUMP00000199173 antibody
    • PUR8_HUMAN antibody
    see all

Images

  • All lanes : Anti-AMPS antibody (ab236582) at 1/500 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : Mouse heart tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 55 kDa

  • Paraffin-embedded human lung tissue stained for AMPS with ab236582 at 1/100 dilution in immunohistochemical analysis.

References

ab236582 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236582.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up