Overview

  • Product name

  • Description

    Rabbit polyclonal to AMSH-LP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to Human AMSH-LP aa 1-50 (N terminal).
    Sequence:

    MDQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNITISEDITPRR


    Database link: NP_065850

  • Positive control

    • Jurkat cell lysate
  • General notes

    Previously labelled as STAMBPL1. 

Properties

Applications

Our Abpromise guarantee covers the use of ab99172 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 50 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function

    Zinc metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains. Does not cleave 'Lys-48'-linked polyubiquitin chains.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Belongs to the peptidase M67C family.
    Contains 1 MPN (JAB/Mov34) domain.
  • Domain

    The JAMM motif is essential for the protease activity.
  • Information by UniProt
  • Database links

  • Alternative names

    • ALMalpha antibody
    • AMSH FP antibody
    • AMSH LP antibody
    • AMSH-like protease antibody
    • AMSH-LP antibody
    • AMSHFP antibody
    • AMSHLP antibody
    • Associated molecule with the SH3 domain of STAM (AMSH) like protein antibody
    • FLJ31524 antibody
    • OTTHUMP00000020055 antibody
    • STALP_HUMAN antibody
    • STAM binding protein like 1 antibody
    • STAM-binding protein-like 1 antibody
    • STAMBPL1 antibody
    see all

Images

  • Anti-AMSH-LP antibody (ab99172) at 1 µg/ml + Jurkat cell lysate at 10 µg

    Predicted band size: 50 kDa



    Gel concentration: 12%

References

This product has been referenced in:

  • Lavorgna A & Harhaj EW An RNA interference screen identifies the Deubiquitinase STAMBPL1 as a critical regulator of human T-cell leukemia virus type 1 tax nuclear export and NF-?B activation. J Virol 86:3357-69 (2012). WB . Read more (PubMed: 22258247) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99172.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up