For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    amylin-rat-endogenous-peptide-ab142399.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Signal Transduction Growth Factors/Hormones Hormones
Share by email

Amylin (rat), Endogenous peptide  (ab142399)

  • Datasheet
  • SDS
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Chemical Structure - Amylin (rat), Endogenous peptide  (ab142399)

    Key features and details

    • Endogenous peptide secreted by pancreatic β-cells
    • CAS Number:
    • Purity: > 95%
    • Soluble in water
    • Form / State: Solid
    • Source: Synthetic

    Overview

    • Product name

      Amylin (rat), Endogenous peptide 
    • Description

      Endogenous peptide secreted by pancreatic β-cells
    • Biological description

      Endogenous peptide secreted by pancreatic β-cells. Potently activates amylin, calcitonin (EC50 = 0.67 nM), CGRP and adrenomedullin receptors. Potently inhibits insulin-stimulated glucose uptake (IC50 = 12 pM). Implicated in type II diabetes. Active in vivo. Human (ab142398) and feline (ab142397) amylin also available.
    • Purity

      > 95%
    • Chemical structure

      Chemical Structure

    Properties

    • Molecular weight

      3918.47
    • Molecular formula

      C167H272N52O53S2
    • Sequence

      KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY (Modifications: C-terminal amide; Disulfide bonds: 2-7)
    • Storage instructions

      Store at +4°C. Store under desiccating conditions. The product can be stored for up to 12 months.
    • Solubility overview

      Soluble in water
    • Handling

      Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.

      Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.

    • Source

      Synthetic

    • Research areas

      • Signal Transduction
      • Growth Factors/Hormones
      • Hormones
      • Biochemicals
      • Product Range
      • New
      • Biochemicals
      • Product Range
      • Just Add Water
      • Biochemicals
      • Chemical Type
      • Biochemicals
      • Biochemicals
      • Chemical Type
      • Bioactive peptides
      • Biochemicals
      • Pharmacology
      • Receptors & Transporters
      • Peptide Receptors
      • Calcitonin and Related Receptors

    Images

    • Chemical Structure - Amylin (rat), Endogenous peptide  (ab142399)
      Chemical Structure - Amylin (rat), Endogenous peptide  (ab142399)
      2D chemical structure image of ab142399, Amylin (rat), Endogenous peptide

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • SDS download

    • Datasheet download

      Download

    References (0)

    Publishing research using ab142399? Please let us know so that we can cite the reference in this datasheet.

    ab142399 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab142399.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES, NOT FOR USE IN HUMANS"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.