Overview

  • Product name

    Anti-ANAPC2 antibody
  • Description

    Rabbit polyclonal to ANAPC2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ANAPC2 aa 1-230.
    Sequence:

    MAAAVVVAEGDSDSRPGQELLVAWNTVSTGLVPPAALGLVSSRTSGAVPP KEEELRAAVEVLRGHGLHSVLEEWFVEVLQNDLQANISPEFWNAISQCEN SADEPQCLLLLLDAFGLLESRLDPYLRSLELLEKWTRLGLLMGTGAQGLR EEVHTMLRGVLFFSTPRTFQEMIQRLYGCFLRVYMQSKRKGEGGTDPELE GELDSRYARRRYYRLLQSPLCAGCSSDKQQ


    Database link: Q9UJX6

  • Positive control

    • IHC-P: Human colon cancer, bladder cancer and pancreatic cancer tissues. ICC/IF: A549 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab234759 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/500.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the cullin family.
  • Information by UniProt
  • Database links

  • Alternative names

    • anapc2 antibody
    • Anaphase promoting complex subunit 2 antibody
    • Anaphase-promoting complex subunit 2 antibody
    • ANC2_HUMAN antibody
    • APC2 antibody
    • Cyclosome subunit 2 antibody
    • KIAA1406 antibody
    • OTTHUMP00000022692 antibody
    • RP11 350O14.5 antibody
    see all

Images

  • Paraffin-embedded human colon cancer tissue stained for ANAPC2 using ab234759 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human bladder cancer tissue stained for ANAPC2 using ab234759 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreatic cancer tissue stained for ANAPC2 using ab234759 at 1/348 dilution in immunohistochemical analysis performed on a Leica BondTM system.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at room temperature. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • 4% formaldehyde-fixed, 0.2% Triton X-100 permeabilized A549 (human lung carcinoma cell line) cells stained for ANAPC2(green) using ab234759 at 1/100 dilution in ICC/IF, followed by Alexa Fluor® 488 conjugated Goat Anti-Rabbit IgG (H+L).

    Counterstained with DAPI.

    Blocked in 10% normal goat serum. The cells were incubated with the primary antibody overnight at 4°C. 

References

ab234759 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234759.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up