Overview

  • Product name

    Anti-Ancient ubiquitous protein 1 antibody
    See all Ancient ubiquitous protein 1 primary antibodies
  • Description

    Rabbit polyclonal to Ancient ubiquitous protein 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human Ancient ubiquitous protein 1 aa 276-420.
    Sequence:

    LLWSLFVPFTVYQVRWLRPVHRQLGEANEEFALRVQQLVAKELGQTGTRL TPADKAEHMKRQRHPRLRPQSAQSSFPPSPGPSPDVQLATLAQRVKEVLP HVPLGVIQRDLAKTGCVDLTITNLLEGAVAFMPEDITKGTQSLPT


    Database link: Q9Y679

  • Positive control

    • WB: RPMI-8226, NIH/3T3 and NBT-II cell lysates. IHC-P: Human pancreas tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224242 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 53 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

Images

  • Paraffin-embedded human pancreas tissue stained for Ancient ubiquitous protein 1 using ab224242 at 1/50 dilution in immunohistochemical analysis.

  • Anti-Ancient ubiquitous protein 1 antibody (ab224242) at 1/100 dilution + RPMI-8226 cell lysate

    Developed using the ECL technique.

    Predicted band size: 53 kDa

  • All lanes : Anti-Ancient ubiquitous protein 1 antibody (ab224242) at 1/100 dilution

    Lane 1 : NIH/3T3 (mouse embryonic fibroblast cell line) cell lysate
    Lane 2 : NBT-II cell lysate

    Developed using the ECL technique.

    Predicted band size: 53 kDa

References

This product has been referenced in:

  • Zhang J  et al. Flaviviruses Exploit the Lipid Droplet Protein AUP1 to Trigger Lipophagy and Drive Virus Production. Cell Host Microbe 23:819-831.e5 (2018). Read more (PubMed: 29902443) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224242.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up