Overview

  • Product name

    Anti-Angiomotin antibody [OTI1F11]
    See all Angiomotin primary antibodies
  • Description

    Mouse monoclonal [OTI1F11] to Angiomotin
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human Angiomotin aa 1-675. Produced in HEK293T cells (NP_573572).
    Sequence:

    MPRAQPSSASYQPVPADPFAIVSRAQQMVEILSDENRNLRQELEGCYEKV ARLQKVETEIQRVSEAYENLVKSSSKREALEKAMRNKLEGEIRRMHDFNR DLRERLETANKQLAEKEYEGSEDTRKTISQLFAKNKESQREKEKLEAELA TARSTNEDQRRHIEIRDQALSNAQAKVVKLEEELKKKQVYVDKVEKMQQA LVQLQAACEKREQLEHRLRTRLERELESLRIQQRQGNCQPTNVSEYNAAA LMELLREKEERILALEADMTKWEQKYLEENVMRHFALDAAATVAAQRDTT VISHSPNTSYDTALEARIQKEEEEILMANKRCLDMEGRIKTLHAQIIEKD AMIKVLQQRSRKEPSKTEQLSCMRPAKSLMSISNAGSGLLSHSSTLTGSP IMEEKRDDKSWKGSLGILLGGDYRAEYVPSTPSPVPPSTPLLSAHSKTGS RDCSTQTERGTESNKTAAVAPISVPAPVAAAATAAAITATAATITTTMVA AAPVAVAAAAAPAAAAAPSPATAAATAAAVSPAAAGQIPAAASVASAAAV APSAAAAAAVQVAPAAPAPVPAPALVPVPAPAAAQASAPAQTQAPTSAPA VAPTPAPTPTPAVAQAEVPASPATGPGPHRLSIPSLTCNPDKTDGPVFHS NTLERKTPIQILGQEPDAEMVEYLI


    Database link: Q4VCS5

  • Positive control

    • WB: pCMV6-ENTRY Angiomotin cDNA transfected HEK-293T cell lysate.
  • General notes

    Clone OTI1F11 (formerly 1F11).

Properties

Applications

Our Abpromise guarantee covers the use of ab236498 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 118 kDa.

Target

  • Function

    Plays a central role in tight junction maintenance via the complex formed with ARHGAP17, which acts by regulating the uptake of polarity proteins at tight junctions. Appears to regulate endothelial cell migration and tube formation. May also play a role in the assembly of endothelial cell-cell junctions.
  • Tissue specificity

    Expressed in placenta and skeletal muscle. Found in the endothelial cells of capillaries as well as larger vessels of the placenta.
  • Sequence similarities

    Belongs to the angiomotin family.
  • Domain

    The coiled coil domain interacts directly with the BAR domain of ARHGAP17.
    The angiostatin binding domain (871-1005) allows the binding to angiostatin.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cell junction > tight junction. Localized on the cell surface. May act as a transmembrane protein.
  • Information by UniProt
  • Database links

  • Alternative names

    • AMOT antibody
    • AMOT_HUMAN antibody
    • Angiomotin antibody
    • Angiomotin p130 isoform antibody
    • KIAA1071 antibody
    see all

Images

  • All lanes : Anti-Angiomotin antibody [OTI1F11] (ab236498) at 1/2000 dilution

    Lane 1 : pCMV6-ENTRY control cDNA transfected HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 2 : pCMV6-ENTRY Angiomotin cDNA transfected HEK-293T cell lysate

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 118 kDa

References

ab236498 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236498.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up