Anti-Angiopoietin 1 antibody (ab231269)
Key features and details
- Rabbit polyclonal to Angiopoietin 1
- Suitable for: WB
- Reacts with: Rat
- Isotype: IgG
Overview
-
Product name
Anti-Angiopoietin 1 antibody
See all Angiopoietin 1 primary antibodies -
Description
Rabbit polyclonal to Angiopoietin 1 -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Rat
Predicted to work with: Mouse, Cow, Dog, Human, Pig -
Immunogen
Recombinant fragment (His-tag) corresponding to Dog Angiopoietin 1 aa 148-266. (Expressed in E.coli).
Sequence:VETQVLNQTSRLEIQLLENSLSTYKLEKQLLQQTNEILKIHEKNSLLEHK ILEMEGKHKEEWDTLKEERENLQVLVTRQTYIIQELEKQLNRATNNNSVL QKQQLELMDTVHNLVNLCT
Database link: Q60FC1 -
Positive control
- WB: Rat liver lysate; Recombinant dog Angiopoietin 1 protein.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab231269 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab231269 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 57 kDa. |
Target
-
Function
Binds and activates TIE2 receptor by inducing its tyrosine phosphorylation. Implicated in endothelial developmental processes later and distinct from that of VEGF. Appears to play a crucial role in mediating reciprocal interactions between the endothelium and surrounding matrix and mesenchyme. Mediates blood vessel maturation/stability. It may play an important role in the heart early development. -
Sequence similarities
Contains 1 fibrinogen C-terminal domain. -
Post-translational
modificationsGlycosylated. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 282140 Cow
- Entrez Gene: 403656 Dog
- Entrez Gene: 284 Human
- Entrez Gene: 11600 Mouse
- Entrez Gene: 397009 Pig
- Entrez Gene: 89807 Rat
- Omim: 601667 Human
- SwissProt: O18920 Cow
see all -
Alternative names
- AGP 1 antibody
- AGP1 antibody
- AGPT antibody
see all
Images
-
Anti-Angiopoietin 1 antibody (ab231269) at 2 µg/ml + Recombinant dog Angiopoietin 1 protein.
Predicted band size: 57 kDa -
Anti-Angiopoietin 1 antibody (ab231269) at 2 µg/ml + Rat liver lysate.
Predicted band size: 57 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab231269 has not yet been referenced specifically in any publications.