Anti-Angiopoietin 1 antibody (ab231269)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-Angiopoietin 1 antibody
See all Angiopoietin 1 primary antibodies -
Description
Rabbit polyclonal to Angiopoietin 1 -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Rat
Predicted to work with: Mouse, Cow, Dog, Human, Pig
-
Immunogen
Recombinant fragment (His-tag) corresponding to Dog Angiopoietin 1 aa 148-266. (Expressed in E.coli).
Sequence:VETQVLNQTSRLEIQLLENSLSTYKLEKQLLQQTNEILKIHEKNSLLEHK ILEMEGKHKEEWDTLKEERENLQVLVTRQTYIIQELEKQLNRATNNNSVL QKQQLELMDTVHNLVNLCT
Database link: Q60FC1 -
Positive control
- WB: Rat liver lysate; Recombinant dog Angiopoietin 1 protein.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
ab231269 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab231269 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 57 kDa. |
Target
-
Function
Binds and activates TIE2 receptor by inducing its tyrosine phosphorylation. Implicated in endothelial developmental processes later and distinct from that of VEGF. Appears to play a crucial role in mediating reciprocal interactions between the endothelium and surrounding matrix and mesenchyme. Mediates blood vessel maturation/stability. It may play an important role in the heart early development. -
Sequence similarities
Contains 1 fibrinogen C-terminal domain. -
Post-translational
modificationsGlycosylated. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 282140 Cow
- Entrez Gene: 403656 Dog
- Entrez Gene: 284 Human
- Entrez Gene: 11600 Mouse
- Entrez Gene: 397009 Pig
- Entrez Gene: 89807 Rat
- Omim: 601667 Human
- SwissProt: O18920 Cow
see all -
Alternative names
- AGP 1 antibody
- AGP1 antibody
- AGPT antibody
see all
Images
-
Western blot - Anti-Angiopoietin 1 antibody (ab231269)Anti-Angiopoietin 1 antibody (ab231269) at 2 µg/ml + Recombinant dog Angiopoietin 1 protein.
Predicted band size: 57 kDa -
Western blot - Anti-Angiopoietin 1 antibody (ab231269)Anti-Angiopoietin 1 antibody (ab231269) at 2 µg/ml + Rat liver lysate.
Predicted band size: 57 kDa
Datasheets and documents
References
ab231269 has not yet been referenced specifically in any publications.
