Overview

  • Product name

    Anti-Angiopoietin 2/ANG2 antibody
    See all Angiopoietin 2/ANG2 primary antibodies
  • Description

    Rabbit polyclonal to Angiopoietin 2/ANG2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Human, Pig
    Predicted to work with: Rat, Cow, Dog
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Pig Angiopoietin 2/ANG2 aa 89-206. (Expressed in E.coli).
    Sequence:

    NNTQWLMKLESYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQ TRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKN SFLEKKVLDMEDKHIVQL


    Database link: Q9BDY7

  • Positive control

    • WB: Recombinant pig Angiopoietin 2/ANG2 protein; Pig and mouse brain lysates; K562 cell lysate.
  • General notes

     This product was previously labelled as Angiopoietin 2

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231251 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231251 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 57 kDa.

Target

Images

  • All lanes : Anti-Angiopoietin 2/ANG2 antibody (ab231251) at 3 µg/ml

    Lane 1 : Pig brain lysate
    Lane 2 : Mouse brain lysate
    Lane 3 : K562 (Human chronic myelogenous leukemia cell line from bone marrow) cell lysate

    Secondary
    All lanes : HRP-linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 57 kDa

  • Anti-Angiopoietin 2/ANG2 antibody (ab231251) at 3 µg/ml + Recombinant pig Angiopoietin 2/ANG2 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 57 kDa

References

ab231251 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231251.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up