For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    angiopoietin-2ang2-antibody-ab8452.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cardiovascular Angiogenesis Growth Factors Angiopoietin
Share by email

Anti-Angiopoietin 2/ANG2 antibody (ab8452)

  • Datasheet
  • SDS
Reviews (4)Q&A (7)References (27)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-Angiopoietin 2/ANG2 antibody (ab8452)
  • Immunocytochemistry/ Immunofluorescence - Anti-Angiopoietin 2/ANG2 antibody (ab8452)

Key features and details

  • Rabbit polyclonal to Angiopoietin 2/ANG2
  • Suitable for: ICC/IF, WB
  • Reacts with: Rat, African green monkey
  • Isotype: IgG

You may also be interested in

Protein
Recombinant human Angiopoietin 2/ANG2 protein (ab123226)
Primary
Product image
Anti-TIE1 (phospho Y1007) + TIE2 (phospho Y992) antibody [EPR1053(N)(B)] (ab151704)
Primary
Product image
Alexa Fluor® 647 Anti-ERG antibody [EPR3864] (ab196149)

View more associated products

Overview

  • Product name

    Anti-Angiopoietin 2/ANG2 antibody
    See all Angiopoietin 2/ANG2 primary antibodies
  • Description

    Rabbit polyclonal to Angiopoietin 2/ANG2
  • Host species

    Rabbit
  • Tested Applications & Species

    Application Species
    ICC/IF
    Rat
    WB
    African green monkey
    See all applications and species data
  • Immunogen

    Synthetic peptide corresponding to Mouse Angiopoietin 2/ANG2 aa 21-40 (N terminal).
    Sequence:

    CNNFRKSVDSTGRRQYQVQNGP


    (Peptide available as ab9077)
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • General notes

     This product was previously labelled as Angiopoietin 2

     

    The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing the problem with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation.

    One factor contributing to the crisis is the use of antibodies that are not suitable. This can lead to misleading results and the use of incorrect data informing project assumptions and direction. To help address this challenge, we have introduced an application and species grid on our primary antibody datasheets to make it easy to simplify identification of the right antibody for your needs.

    Learn more here.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.1% Sodium azide
    Constituents: 0.42% Potassium phosphate, 0.87% Sodium chloride
  • Concentration information loading...
  • Purity

    Whole antiserum
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

    • Cardiovascular
    • Angiogenesis
    • Growth Factors
    • Angiopoietin

Associated products

  • Compatible Secondaries

    • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
    • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
  • Immunizing Peptide (Blocking)

    • Mouse Angiopoietin 2/ANG2 peptide (ab9077)
  • Isotype control

    • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
  • Recombinant Protein

    • Recombinant human Angiopoietin 2/ANG2 protein (ab123226)
    • Recombinant Human Angiopoietin 2/ANG2 protein (His tag) (ab220589)

Applications

The Abpromise guarantee

Our Abpromise guarantee covers the use of ab8452 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Guaranteed

Tested applications are guaranteed to work and covered by our Abpromise guarantee.

Predicted

Predicted to work for this combination of applications and species but not guaranteed.

Incompatible

Does not work for this combination of applications and species.

Application Species
ICC/IF
Rat
WB
African green monkey
Application Abreviews Notes
ICC/IF (1)
1/200.
WB (2)
1/500. Can be blocked with Mouse Angiopoietin 2/ANG2 peptide (ab9077). There is reaction with serum in the cell supernatants, which results in strong background and makes it difficult to see the angiopoietins in cell supernatants. However when precipitated (using soluble Tie2) the signals are very good and strong.
Notes
ICC/IF
1/200.
WB
1/500. Can be blocked with Mouse Angiopoietin 2/ANG2 peptide (ab9077). There is reaction with serum in the cell supernatants, which results in strong background and makes it difficult to see the angiopoietins in cell supernatants. However when precipitated (using soluble Tie2) the signals are very good and strong.

Target

  • Function

    Can induce tyrosine phosphorylation of TIE2. Binds to TIE2 receptor and counteracts blood vessel maturation/stability mediated by angiopoietin-1. Its function may be context-dependent. In the absence of angiogenic inducers, such as VEGF, ANG2-mediated loosening of cell-matrix contacts may induce endothelial cell apoptosis with consequent vascular regression. In concert with VEGF, it may facilitate endothelial cell migration and proliferation, thus serving as a permissive angiogenic signal.
  • Sequence similarities

    Contains 1 fibrinogen C-terminal domain.
  • Domain

    The Fibrinogen C-terminal domain mediates interaction with the TEK/TIE2 receptor.
  • Cellular localization

    Secreted.
  • Target information above from: UniProt accession O15123 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 89805 Rat
    • SwissProt: O35462 Rat
    • Unigene: 138360 Rat
    • Alternative names

      • AGPT 2 antibody
      • Agpt2 antibody
      • ANG 2 antibody
      • ANG-2 antibody
      • ANG2 antibody
      • Angiopoietin 2a antibody
      • Angiopoietin 2B antibody
      • Angiopoietin-2 antibody
      • Angiopoietin2 antibody
      • ANGP2_HUMAN antibody
      • ANGPT 2 antibody
      • Angpt2 antibody
      • Tie2 ligand antibody
      see all

    Images

    • Western blot - Anti-Angiopoietin 2/ANG2 antibody (ab8452)
      Western blot - Anti-Angiopoietin 2/ANG2 antibody (ab8452)This image is courtesy of Marion Scharpfenecker 2002

      Supernatants of mouse angiopoietin-expressing endothelial cells. Soluble Tie 2 was used to precipitate the angiopoietins to reduce background.

      Lane 1 - mock
      Lane 2 - mouse angiopoietin-2 (clone 2-9) expressing cells
      Lane 3 - mouse angiopoietin-1 (clone 1-15) expressing cells
      Lane 4 - mouse angiopoietin-1 (clone 1-8) expressing cells
      Lane 5 - wt

       

    • Immunocytochemistry/ Immunofluorescence - Anti-Angiopoietin 2/ANG2 antibody (ab8452)
      Immunocytochemistry/ Immunofluorescence - Anti-Angiopoietin 2/ANG2 antibody (ab8452)
      ICC/IF image of ab8452 stained PC12 cells. The cells were 100% methanol fixed (5 min) and then incubated in 1%BSA / 10% normal goat serum / 0.3M glycine in 0.1% PBS-Tween for 1h to permeabilise the cells and block non-specific protein-protein interactions. The cells were then incubated with the antibody (ab8452, 1/200 dilution) overnight at +4°C. The secondary antibody (green) was Alexa Fluor® 488 goat anti-rabbit IgG (H+L) used at a 1/1000 dilution for 1h. Alexa Fluor® 594 WGA was used to label plasma membranes (red) at a 1/200 dilution for 1h. DAPI was used to stain the cell nuclei (blue) at a concentration of 1.43µM.

    Protocols

    • Immunohistochemistry protocols
    • Immunocytochemistry & immunofluorescence protocols
    • Western blot protocols

    Click here to view the general protocols

    Datasheets and documents

    • SDS download

    • Datasheet download

      Download

    References (27)

    Publishing research using ab8452? Please let us know so that we can cite the reference in this datasheet.

    ab8452 has been referenced in 27 publications.

    • Shang A  et al. Exosomal miR-183-5p promotes angiogenesis in colorectal cancer by regulation of FOXO1. Aging (Albany NY) 12:8352-8371 (2020). PubMed: 32364530
    • Wang T  et al. Metastasis-Associated 1 (MTA1) Gene Expression Promotes Angiogenesis in Mouse Xenografts from Human Non-Small Cell Lung Cancer (NSCLC) Cells. Med Sci Monit 25:484-491 (2019). PubMed: 30651530
    • Yin Z  et al. Macrophage-derived exosomal microRNA-501-3p promotes progression of pancreatic ductal adenocarcinoma through the TGFBR3-mediated TGF-ß signaling pathway. J Exp Clin Cancer Res 38:310 (2019). PubMed: 31307515
    • Wang X  et al. Expression of Long Noncoding RNA LIPCAR Promotes Cell Proliferation, Cell Migration, and Change in Phenotype of Vascular Smooth Muscle Cells. Med Sci Monit 25:7645-7651 (2019). PubMed: 31603865
    • Wei M  et al. Upregulation of Protease-Activated Receptor 2 Promotes Proliferation and Migration of Human Vascular Smooth Muscle Cells (VSMCs). Med Sci Monit 25:8854-8862 (2019). PubMed: 31756174
    View all Publications for this product

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    1-10 of 11 Abreviews or Q&A

    Immunocytochemistry/ Immunofluorescence abreview for Anti-Angiopoietin 2/ANG2 antibody

    Good
    Abreviews
    Abreviews
    abreview image
    Application
    Immunocytochemistry/ Immunofluorescence
    Sample
    Human Cell (Human Umbilical Vein Endothelial Cell)
    Permeabilization
    Yes - 0.5% Triton X-100 for 20min
    Specification
    Human Umbilical Vein Endothelial Cell
    Blocking step
    Serum as blocking agent for 30 minute(s) · Concentration: 5% · Temperature: 37°C
    Fixative
    Formaldehyde
    Read More

    Abcam user community

    Verified customer

    Submitted Aug 23 2017

    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) abreview for Anti-Angiopoietin 2/ANG2 antibody

    Poor
    Abreviews
    Abreviews
    abreview image
    Application
    Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
    Sample
    Mouse Tissue sections (mouse kidney)
    Antigen retrieval step
    Heat mediated - Buffer/Enzyme Used: Tris/EDTA pH 9.0
    Permeabilization
    Yes - 0.5% Triton X100
    Specification
    mouse kidney
    Blocking step
    2.5% BSA / 2.5% donkey serum as blocking agent for 4 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C
    Fixative
    Paraformaldehyde
    Read More

    Abcam user community

    Verified customer

    Submitted Jun 03 2016

    Western blot abreview for Anti-Angiopoietin 2/ANG2 antibody

    Average
    Abreviews
    Abreviews
    abreview image
    Application
    Western blot
    Sample
    Mouse Tissue lysate - whole (lung)
    Gel Running Conditions
    Non-reduced Non-Denaturing (Native)
    Loading amount
    30 µg
    Treatment
    OVA I.P, I.N
    Specification
    lung
    Blocking step
    Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 25°C
    Read More

    Abcam user community

    Verified customer

    Submitted Oct 05 2015

    Western blot abreview for Anti-Angiopoietin 2/ANG2 antibody

    Below Average
    Abreviews
    Abreviews
    Application
    Western blot
    Sample
    Mouse Tissue lysate - whole (lung)
    Gel Running Conditions
    Non-reduced Denaturing (10%gel)
    Loading amount
    50 µg
    Treatment
    OVA-induce
    Specification
    lung
    Blocking step
    Milk as blocking agent for 2 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 38°C
    Read More

    Abcam user community

    Verified customer

    Submitted Dec 03 2012

    Question

    Dear technical team,

    Our customer directly claimed to US.technical team and received e-mail of below.
    So she would like to receive a credit note.
    Please check attached Original Message.

    Read More

    Abcam community

    Verified customer

    Asked on Nov 28 2012

    Answer

    Thank you very much for your reply.

    I will forward your request to my colleagues in our Hong Kong office, and someone will be in touch with you promptly.

    Have a nice day!

    Read More

    Abcam Scientific Support

    Answered on Nov 28 2012

    Question

    AbID: 8452, Anti-Angiopoietin 2 antibody Rating: Below Average Sample: Species: Mouse Type: Tissue lysate - whole Loading amount: 50 µg Specification: lung Treatment: OVA-induce Application: Application: Gel Running Conditions: Non-reduced Denaturing (10%gel) Blocking step: Milk as blocking agent for 2 hours at 38°C Blocking Concentration: 5% Other detail: Dilution: 1/1000 Incubation time: 18 hours at 4°C Diluent: 5% milk Secondary Antibody: Name: Non-Abcam Antibody was used: Goat anti- rabbit lgG-hrp Conjugation: HRP Dilution: 1/15000 Detection: Detection method: ECL Exposure: 1 minute and 0 seconds Bands: Specific: 75 kDa Non-specific: several kDa Additional Data:

    Read More

    Abcam community

    Verified customer

    Asked on Nov 19 2012

    Answer

    Thank you very much for your valuable review.
    I'm writing to follow-up with you, as the results were below average and we do guarantee this antibody to work in Western blot with mouse samples. I'm sorry to see that there were several non-specific bands on the blot. We have found that ab8452 gives more specific results following immunoprecipitation. I'd be happy to offer you a replacement with a different antibody such as ab125692, or alternatively a credit or refund.
    https://www.abcam.com/Angiopoietin-2-antibody-ab125692.html
    If you would like to accept one of these options, please let me know your original order or PO number and I'll arrange this for you promptly.
    I look forward to hearing from you. If you have any questions or need anything else, please let me know and I'll be happy to help.

    Read More

    Abcam Scientific Support

    Answered on Nov 19 2012

    Question

    In the western blot shown, you mentioned using sTie2 to precipitate. do you have a protocol for that?

    Read More

    Abcam community

    Verified customer

    Asked on Oct 05 2006

    Answer

    Thank you for your enquiry. The Tie2 precipitation experiment was performed by an outside collaborator, and we do not have any further information at hand regarding this. I have tried to email the collaborator to see if we can obtain this information, as several customers have enquired about this. I see that one of my colleagues attempted previously and we did not receive a reply, so I am not optimistic about getting further information. If I do obtain the information you requested, I will forward it along to you.

    Read More

    Abcam Scientific Support

    Answered on Oct 06 2006

    Question

    How specific are these antibodies to mouse? How specific are they to 1 vs. 2 and vice versa?

    Read More

    Abcam community

    Verified customer

    Asked on Jun 10 2005

    Answer

    Thank you for your enquiry. ab8451 is specific for mouse Angiopoietin 1. ab8452 cross-reacts with human (reacts with Ang-2 and weakly with Ang-1) and mouse (specific for mAng-2). There is little sequence homology between the two epitopes of 1 versus 2, therefore, I do not expect either antibody to cross react with the other form. For example, ab8451 is specific for mouse Angiopoietin 1 and should not cross react with mouse Angiopoietin 2. Here is the clustalW alignment of the 2 epitopes: mouseAng2 MWQIIFLTFGWDLVLAS--AYSNFRKSVDSTGRRQYQVQNGP mouseAng1 --MTVFLSFAFFAAILTHIGCSNQRRNPENGGRRYNRIQHGQ :**:*.: .: : . ** *:. :. *** ::*:* I hope this information helps, please do not hesitate to contact us if you need any more advice or information,

    Read More

    Abcam Scientific Support

    Answered on Jun 10 2005

    Question

    On your website, there is a representative Western blot using the Ang2 ab (ab8452) performed by Marion Scharpfenecker. Do you have the protocol for this procedure? Why is there a band at 50KD? Is the antibody non-specific? Thank you.

    Read More

    Abcam community

    Verified customer

    Asked on Oct 13 2003

    Answer

    All the information available for this product is listed on the on-line datasheet (price, datasheet, publication, suitability, cross-reactivity). Angiopoietin-2 is a naturally occurring antagonist of angiopoietin-1. Western blot analysis showed that ANG2 is expressed as a homodimeric 68 kDa protein that is reduced to around 50 kD, after deglycosylation. We would refer you to the extensive “Resources (Popular Protocols)” section on the Abcam website, you may find useful information there.

    Read More

    Asdf Edo

    Abcam Scientific Support

    Answered on Oct 13 2003

    Question

    Has this antibody been used for IHC on mouse paraffin sections? If so, at what concentration? What type of antigen retrieval is needed, if any? Please forward any pertinant protocol info. thnx.

    Read More

    Abcam community

    Verified customer

    Asked on May 28 2002

    Answer

    This antibody has never been tested in IHC on mouse tissue sections, therefore we can't guarantee results.

    Read More

    Abcam Scientific Support

    Answered on May 28 2002

    1-10 of 11 Abreviews or Q&A

    •  Previous
    • 1
    • 2
    • Next 

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.