Overview

  • Product name

    Anti-Angiotensinogen antibody
    See all Angiotensinogen primary antibodies
  • Description

    Rabbit polyclonal to Angiotensinogen
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Gorilla
  • Immunogen

    Recombinant fragment corresponding to Human Angiotensinogen aa 44-427.
    Sequence:

    VIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQLVLVAA KLDTEDKLRAAMVGMLANFLGFRIYGMHSELWGVVHGATVLSPTAVFGTL ASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKVLSALQAVQGLLVA QGRADSQAQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPVVLPRSLDFTE LDVAAEKIDRFMQAVTGWKTGCSLMGASVDSTLAFNTYVHFQGKMKGFSL LAEPQEFWVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVTQVPFTESACLL LIQPHYASDLDKVEGLTFQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDLQ DLLAQAELPAILHTELNLQKLSNDRIRVGEVLNS


    Database link: P01019

  • Positive control

    • IHC-P: Human gastric cancer, liver and human prostate tissues. WB: HepG2 and MCF-7 whole cell lysates. ICC/IF: HepG2 cells.

Applications

Our Abpromise guarantee covers the use of ab236317 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/400.
WB 1/500 - 1/5000. Predicted molecular weight: 53 kDa.
ICC/IF 1/50 - 1/200.

Target

  • Function

    Essential component of the renin-angiotensin system (RAS), a potent regulator of blood pressure, body fluid and electrolyte homeostasis. In response to lowered blood pressure, the enzyme renin cleaves angiotensinogen to produce angiotensin-1 (angiotensin 1-10). Angiotensin-1 is a substrate of ACE (angiotensin converting enzyme) that removes a dipeptide to yield the physiologically active peptide angiotensin-2 (angiotensin 1-8). Angiotensin-1 and angiotensin-2 can be further processed to generate angiotensin-3 (angiotensin 2-8), angiotensin-4 (angiotensin 3-8). Angiotensin 1-7 is cleaved from angiotensin-2 by ACE2 or from angiotensin-1 by MME (neprilysin). Angiotensin 1-9 is cleaved from angiotensin-1 by ACE2.
    Angiotensin-2 acts directly on vascular smooth muscle as a potent vasoconstrictor, affects cardiac contractility and heart rate through its action on the sympathetic nervous system, and alters renal sodium and water absorption through its ability to stimulate the zona glomerulosa cells of the adrenal cortex to synthesize and secrete aldosterone.
    Angiotensin-3 stimulates aldosterone release.
    Angiotensin 1-7 is a ligand for the G-protein coupled receptor MAS1 (By similarity). Has vasodilator and antidiuretic effects (By similarity). Has an antithrombotic effect that involves MAS1-mediated release of nitric oxide from platelets.
  • Tissue specificity

    Expressed by the liver and secreted in plasma.
  • Involvement in disease

    Genetic variations in AGT are a cause of susceptibility to essential hypertension (EHT) [MIM:145500]. Essential hypertension is a condition in which blood pressure is consistently higher than normal with no identifiable cause.
    Defects in AGT are a cause of renal tubular dysgenesis (RTD) [MIM:267430]. RTD is an autosomal recessive severe disorder of renal tubular development characterized by persistent fetal anuria and perinatal death, probably due to pulmonary hypoplasia from early-onset oligohydramnios (the Potter phenotype).
  • Sequence similarities

    Belongs to the serpin family.
  • Post-translational
    modifications

    Beta-decarboxylation of Asp-34 in angiotensin-2, by mononuclear leukocytes produces alanine. The resulting peptide form, angiotensin-A, has the same affinity for the AT1 receptor as angiotensin-2, but a higher affinity for the AT2 receptor.
  • Cellular localization

    Secreted.
  • Information by UniProt
  • Database links

  • Alternative names

    • Aangiotensinogen (serpin peptidase inhibitor clade A member 8) antibody
    • AGT antibody
    • AI265500 antibody
    • Alpha 1 antiproteinase antitrypsin antibody
    • Ang antibody
    • Ang I antibody
    • Ang II antibody
    • Ang III antibody
    • AngII antibody
    • Angiotensin I antibody
    • Angiotensin II antibody
    • Angiotensin III antibody
    • Angiotensin-3 antibody
    • Angiotensinogen (PAT) antibody
    • Angiotensinogen antibody
    • ANGT_HUMAN antibody
    • ANHU antibody
    • ANRT antibody
    • AT-2 antibody
    • AT-II antibody
    • Des-Asp[1]-angiotensin II antibody
    • FLJ92595 antibody
    • FLJ97926 antibody
    • MGC105326 antibody
    • PAT antibody
    • Pre angiotensinogen antibody
    • Serine (or cysteine) proteinase inhibitor antibody
    • Serpin A8 antibody
    • Serpin peptidase inhibitor clade A member 8 antibody
    • SERPINA8 antibody
    see all

Images

  • All lanes : Anti-Angiotensinogen antibody (ab236317) at 1/500 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 2 : MCF-7 (human breast adenocarcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 53 kDa

  • Paraffin-embedded human prostate tissue stained for Angiotensinogen using ab236317 at 1/400 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for Angiotensinogen (green) using ab236317 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

     

  • Paraffin-embedded human liver tissue stained for Angiotensinogen using ab236317 at 1/400 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • Paraffin-embedded human gastric cancer tissue stained for Angiotensinogen using ab236317 at 1/100 dilution in immunohistochemical analysis.

References

ab236317 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236317.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up