Overview

  • Product name
  • Description
    Rabbit polyclonal to ANGPTL3
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human ANGPTL3 aa 1-460.
    Sequence:

    MFTIKLLLFIVPLVISSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGL LQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELR RTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQ NQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIE NQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIY NRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWE NYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFY LGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSG GWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKML IHPTDSESFE


    Database link: Q9Y5C1

  • Positive control
    • Liver and kidney cell line extracts.

Properties

Applications

Our Abpromise guarantee covers the use of ab175288 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 54 kDa.

Target

Images

  • All lanes : Anti-ANGPTL3 antibody (ab175288) at 1/500 dilution

    Lane 1 : Liver cell line extracts
    Lane 2 : Kidney cell line extracts

    Predicted band size: 54 kDa

References

This product has been referenced in:
  • Wang N  et al. Fenofibrate Exerts Protective Effects in Diabetic Retinopathy via Inhibition of the ANGPTL3 Pathway. Invest Ophthalmol Vis Sci 59:4210-4217 (2018). Read more (PubMed: 30128492) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab175288.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up