Overview

  • Product name

    Anti-Anillin antibody [CL0301]
    See all Anillin primary antibodies
  • Description

    Mouse monoclonal [CL0301] to Anillin
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Anillin aa 333-468.
    Sequence:

    IVKSTLSQTVPSKGELSREICLQSQSKDKSTTPGGTGIKPFLERFGERCQ EHSKESPARSTPHRTPIITPNTKAIQERLFKQDTSSSTTHLAQQLKQERQ KELACLRGRFDKGNIWSAEKGGNSKSKQLETKQETH


    Database link: Q9NQW6

  • Epitope

    Binds to an epitope located within the peptide sequence PSKGELSREICLQSQ as determined by overlapping synthetic peptides.
  • Positive control

    • Human lung adenocarcinoma, testis, rectum and colorectal tumor tissues; U-251 MG cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab211868 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/500 - 1/1000. Predicted molecular weight: 124 kDa.

Target

  • Function

    Required for cytokinesis. Essential for the structural integrity of the cleavage furrow and for completion of cleavage furrow ingression.
  • Tissue specificity

    Ubiquitously expressed. Present at highest levels in the brain, at high levels in the placenta and testis, at intermediate levels in the intestine, ovary, skeletal muscle and thymus and at lower levels in heart, kidney, liver, lung, pancreas, prostate and spleen. Overexpressed in many tumor types including breast, colorectal, endometrial, hepatic, kidney, lung, ovarian and pancreatic tumors.
  • Sequence similarities

    Contains 1 PH domain.
  • Developmental stage

    Expressed in fetal brain, heart, kidney, liver, lung, skeletal muscle, spleen and thymus. In dividing cells expression increases during S and G2 phases, peaks at mitosis and subsequently drops as cells enter G1 phase.
  • Post-translational
    modifications

    Phosphorylated during mitosis.
    Ubiquitinated, and this requires FZR1/CDH1.
  • Cellular localization

    Nucleus. Cytoplasm > cytoskeleton. Cytoplasm > cell cortex. Mainly found in the nucleus during interphase. Colocalizes with cortical F-actin upon nuclear envelope breakdown in mitosis and subsequently concentrates in the area of the prospective contractile ring in anaphase. This pattern persists until telophase, when the protein becomes concentrated in the midbody.
  • Information by UniProt
  • Database links

  • Alternative names

    • Actin binding protein scraps homolog Drosophila antibody
    • Actin binding protein anillin antibody
    • Actin-binding protein anillin antibody
    • Anillin actin binding protein antibody
    • anln antibody
    • ANLN_HUMAN antibody
    • DKFZp779A055 antibody
    • FSGS8 antibody
    • Scra antibody
    • Scraps antibody
    • Scraps homolog antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human colorectal tumor tissue labeling Anillin with ab211868 at 1/50 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human rectum tissue labeling Anillin with ab211868 at 1/50 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human testis tissue labeling Anillin with ab211868 at 1/50 dilution.

  • Immunohistochemical analysis of paraffin-embedded Human lung adenocarcinoma tissue labeling Anillin with ab211868 at 1/50 dilution.

  • Anti-Anillin antibody [CL0301] (ab211868) at 1/500 dilution + U-251 MG cell lysate

    Predicted band size: 124 kDa

References

ab211868 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211868.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up