Overview

  • Product name

    Anti-Anillin antibody [CL0303]
    See all Anillin primary antibodies
  • Description

    Mouse monoclonal [CL0303] to Anillin
  • Host species

    Mouse
  • Tested applications

    Suitable for: ICC/IF, IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Anillin aa 333-468.
    Sequence:

    IVKSTLSQTVPSKGELSREICLQSQSKDKSTTPGGTGIKPFLERFGERCQ EHSKESPARSTPHRTPIITPNTKAIQERLFKQDTSSSTTHLAQQLKQERQ KELACLRGRFDKGNIWSAEKGGNSKSKQLETKQETH


    Database link: Q9NQW6

  • Epitope

    Binds to an epitope located within the peptide sequence LRGRFDKGNIWSAEK (438-452 aa) as determined by overlapping synthetic peptides.
  • Positive control

    • U251 cell line lysate; Human colorectal cancer, Human lung cancer, Human testis, Human colon, Human stomach, Human tonsil and Human liver tissues; HeLa, A431, MCF7, U2OS and U251 cells.
  • General notes

    Marker for Nucleus without Nucleoli

Properties

Applications

Our Abpromise guarantee covers the use of ab211872 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/500 - 1/1000. Predicted molecular weight: 124 kDa.

Target

  • Function

    Required for cytokinesis. Essential for the structural integrity of the cleavage furrow and for completion of cleavage furrow ingression.
  • Tissue specificity

    Ubiquitously expressed. Present at highest levels in the brain, at high levels in the placenta and testis, at intermediate levels in the intestine, ovary, skeletal muscle and thymus and at lower levels in heart, kidney, liver, lung, pancreas, prostate and spleen. Overexpressed in many tumor types including breast, colorectal, endometrial, hepatic, kidney, lung, ovarian and pancreatic tumors.
  • Sequence similarities

    Contains 1 PH domain.
  • Developmental stage

    Expressed in fetal brain, heart, kidney, liver, lung, skeletal muscle, spleen and thymus. In dividing cells expression increases during S and G2 phases, peaks at mitosis and subsequently drops as cells enter G1 phase.
  • Post-translational
    modifications

    Phosphorylated during mitosis.
    Ubiquitinated, and this requires FZR1/CDH1.
  • Cellular localization

    Nucleus. Cytoplasm > cytoskeleton. Cytoplasm > cell cortex. Mainly found in the nucleus during interphase. Colocalizes with cortical F-actin upon nuclear envelope breakdown in mitosis and subsequently concentrates in the area of the prospective contractile ring in anaphase. This pattern persists until telophase, when the protein becomes concentrated in the midbody.
  • Information by UniProt
  • Database links

  • Alternative names

    • Actin binding protein scraps homolog Drosophila antibody
    • Actin binding protein anillin antibody
    • Actin-binding protein anillin antibody
    • Anillin actin binding protein antibody
    • anln antibody
    • ANLN_HUMAN antibody
    • DKFZp779A055 antibody
    • FSGS8 antibody
    • Scra antibody
    • Scraps antibody
    • Scraps homolog antibody
    see all

Images

  • All lanes : Anti-Anillin antibody [CL0303] (ab211872)

    All lanes : U-251 cells, transfected with control siRNA

    Predicted band size: 124 kDa



    Downregulation of antibody signal confirms target specificity. Remaining % intensity, relative control lane, is indicated. Anti-GAPDH monoclonal antibody was used as loading control.

  • Immunofluorescent analysis of formalin fixed, Triton X-100 permealized U251 cells labeling Anillin with ab211872 at 4 μg/ml dilution showing cell cycle dependent nuclear (without nucleoli) staining in green. Microtubules are visualized in red.

  • Immunohistochemical analysis of paraffin-embedded, formalin fixed Human tonsil tissue labeling Anillin with ab211872 at 1/50 dilution.

  • Anti-Anillin antibody [CL0303] (ab211872) at 1/500 dilution + U251 cell line lysate

    Predicted band size: 124 kDa

  • Immunofluorescent analysis of formalin fixed, Triton X-100 permealized U2OS cells labeling Anillin with ab211872 at 4 μg/ml dilution showing cell cycle dependent nuclear (without nucleoli) staining in green. Microtubules are visualized in red.

  • Immunofluorescent analysis of formalin fixed, Triton X-100 permealized MCF7 cells labeling Anillin with ab211872 at 4 μg/ml dilution showing cell cycle dependent nuclear (without nucleoli) staining in green. Microtubules are visualized in red.

  • Immunofluorescent analysis of formalin fixed, Triton X-100 permealized A431 cells labeling Anillin with ab211872 at 4 μg/ml dilution showing cell cycle dependent nuclear (without nucleoli) staining in green. Microtubules are visualized in red.

  • Immunofluorescent analysis of formalin fixed, Triton X-100 permealized HeLa cells labeling Anillin with ab211872 at 4 μg/ml dilution showing cell cycle dependent nuclear (without nucleoli) staining in green. Microtubules are visualized in red.

  • Negative control: Immunohistochemical analysis of paraffin-embedded, formalin fixed Human liver tissue labeling Anillin with ab211872 at 1/50 dilution shows absence of staining.

  • Immunohistochemical analysis of paraffin-embedded, formalin fixed Human stomach tissue labeling Anillin with ab211872 at 1/50 dilution.

  • Immunohistochemical analysis of paraffin-embedded, formalin fixed Human colon tissue labeling Anillin with ab211872 at 1/50 dilution.

  • Immunohistochemical analysis of paraffin-embedded, formalin fixed Human testis tissue labeling Anillin with ab211872 at 1/50 dilution.

  • Immunohistochemical analysis of paraffin-embedded, formalin fixed Human lung cancer tissue labeling Anillin with ab211872 at 1/50 dilution.

  • Immunohistochemical analysis of paraffin-embedded, formalin fixed Human colorectal cancer tissue labeling Anillin with ab211872 at 1/50 dilution.

References

This product has been referenced in:

  • Takayama KI  et al. Integrative Genomic Analysis of OCT1 Reveals Coordinated Regulation of Androgen Receptor in Advanced Prostate Cancer. Endocrinology 160:463-472 (2019). Read more (PubMed: 30649323) »
See 1 Publication for this product

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Application
Western blot
Sample
Human Cell lysate - whole cell (HeLa)
Gel Running Conditions
Reduced Denaturing (4-12% Bis-Tris)
Loading amount
15 µg
Treatment
Non-targeting control or Anillin siRNA, 72h
Specification
HeLa
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 20°C

Abcam user community

Verified customer

Submitted Feb 06 2019

Application
Western blot
Sample
Human Cell lysate - whole cell (HeLa)
Gel Running Conditions
Reduced Denaturing (4-12% Bis Tris Nupage gel)
Loading amount
10 µg
Specification
HeLa
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 21°C

Abcam user community

Verified customer

Submitted Nov 16 2018

Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (HeLa)
Permeabilization
Yes - 0.3% tritonx100
Specification
HeLa
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 1% · Temperature: 21°C
Fixative
Paraformaldehyde

Dr. Stephen Terry

Verified customer

Submitted Nov 16 2018

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up