Anti-ANK-3 antibody [N106/43] (ab247206)
Key features and details
- Mouse monoclonal [N106/43] to ANK-3
- Suitable for: IHC-Fr
- Reacts with: Rat
- Isotype: IgG1
Overview
-
Product name
Anti-ANK-3 antibody [N106/43]
See all ANK-3 primary antibodies -
Description
Mouse monoclonal [N106/43] to ANK-3 -
Host species
Mouse -
Specificity
Does not cross-react with Ankyrin-B.
-
Tested applications
Suitable for: IHC-Frmore details -
Species reactivity
Reacts with: Rat
Predicted to work with: Human -
Immunogen
Fusion protein corresponding to Human ANK-3 aa 873-2614. 92% identity.
Sequence:EDAMTGDTDKYLGPQDLKELGDDSLPAEGYMGFSLGARSASLRSFSSDRS YTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSLRHYSWAADTLDN VNLVSSPIHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITC RLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRG KERELIVLRSENGETWKEHQFDSKNEDLTELLNGMDEELDSPEELGKKRI CRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALT KRIRVGLQAQPVPDEIVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPV PPPSGEGVSNGYKGDTTPNLRLLCSITGGTSPAQWEDITGTTPLTFIKDC VSFTTNVSARFWLADCHQVLETVGLATQLYRELICVPYMAKFVVFAKMND PVESSLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGN LAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKTTK GLPQTAVCNLNITLPAHKKIEKTDRRQSFASLALRKRYSYLTEPGMSPQS PCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSF MLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGTRS FADENNVFHDPVDDGPPVVTAEDASLEDSKLEDSVPLTEMPEAVDVDESQ LENVCLSWQNETSSGNLESCAQARRVTGGLLDRLDDSPDQCRDSITSYLK GEAGKFEANGSHTEITPEAKTKSYFPESQNDVGKQSTKETLKPKIHGSGH VEEPASPLAAYQKSLEETSKLIIEETKPCVPVSMKKMSRTSPADGKPRLS LHEEEGSSGSEQKQGEGFKVKTKKEIRHVEKKAH
Database link: Q12955-6 -
Positive control
- IHC-Fr: Rat axon initial segments, cortex, hippocampus CA1 tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Myeloma supernatant. -
Concentration information loading...
-
Purity
Tissue culture supernatant -
Purification notes
Myeloma supernatant. -
Clonality
Monoclonal -
Clone number
N106/43 -
Myeloma
Sp2/0 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
Applications
Our Abpromise guarantee covers the use of ab247206 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-Fr | Use at an assay dependent concentration. As a general guide the starting working concentration for the antibody should be used between 0.1 and 10 µg/mL. |
Target
-
Function
In skeletal muscle, required for costamere localization of DMD and betaDAG1 (By similarity). Membrane-cytoskeleton linker. May participate in the maintenance/targeting of ion channels and cell adhesion molecules at the nodes of Ranvier and axonal initial segments. Regulates KCNA1 channel activity in function of dietary Mg(2+) levels, and thereby contributes to the regulation of renal Mg(2+) reabsorption (PubMed:23903368).
Isoform 5: May be part of a Golgi-specific membrane cytoskeleton in association with beta-spectrin. -
Tissue specificity
Expressed in brain, neurons, muscles and other tissues. -
Involvement in disease
Genetic variations in ANK3 may be associated with autism spectrum disorders susceptibility.
Mental retardation, autosomal recessive 37 -
Sequence similarities
Contains 23 ANK repeats.
Contains 1 death domain.
Contains 2 ZU5 domains. -
Developmental stage
Up-regulated during muscle cell differentiation. -
Domain
The tandem configuration of the two ZU5 and the UPA domains forms a structural supramodule termed ZZU. ZU5-1 mediates interaction with beta-spectrin, and the ZU5-1/UPA interface is required for ankyrin's function other than binding to spectrin. -
Cellular localization
Cytoplasm, cytoskeleton. Cell projection, axon. Cell membrane, sarcolemma. Cell junction, synapse, postsynaptic cell membrane. Lysosome. In skeletal muscle, localized at costameres and neuromuscular junctions. In macrophages, associated with lysosomes and Cytoplasm, cytoskeleton. Golgi apparatus. - Information by UniProt
-
Database links
- Entrez Gene: 288 Human
- Entrez Gene: 361833 Rat
- Omim: 600465 Human
- SwissProt: Q12955 Human
- SwissProt: O70511 Rat
- Unigene: 499725 Human
- Unigene: 690023 Human
- Unigene: 731403 Human
see all -
Alternative names
- ANK-3 antibody
- ANK3 antibody
- ANK3_HUMAN antibody
see all
Images
-
Frozen sections of rat hippocampus CA1 tissue stained for ANK-3 using ab247206 in immunohistochemical analysis.
-
Frozen sections of rat axon initial segment tissue stained for ANK-3 using ab247206 in immunohistochemical analysis.
-
Frozen sections of rat cortex tissue stained for ANK-3 using ab247206 in immunohistochemical analysis.
-
Frozen sections of rat hippocampus CA1 tissue stained for ANK-3 using ab247206 in immunohistochemical analysis.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab247206 has not yet been referenced specifically in any publications.