For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    ank-3-antibody-n10643-ab247206.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Neuroscience Neurotransmission Intracellular Signaling Cytoskeletal
Share by email

Anti-ANK-3 antibody [N106/43] (ab247206)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Immunohistochemistry (Frozen sections) - Anti-ANK-3 antibody [N106/43] (ab247206)
  • Immunohistochemistry (Frozen sections) - Anti-ANK-3 antibody [N106/43] (ab247206)
  • Immunohistochemistry (Frozen sections) - Anti-ANK-3 antibody [N106/43] (ab247206)
  • Immunohistochemistry (Frozen sections) - Anti-ANK-3 antibody [N106/43] (ab247206)

Key features and details

  • Mouse monoclonal [N106/43] to ANK-3
  • Suitable for: IHC-Fr
  • Reacts with: Rat
  • Isotype: IgG1

You may also be interested in

Secondary
Product image
Goat Anti-Mouse IgG H&L (HRP) (ab205719)

View more associated products

Overview

  • Product name

    Anti-ANK-3 antibody [N106/43]
    See all ANK-3 primary antibodies
  • Description

    Mouse monoclonal [N106/43] to ANK-3
  • Host species

    Mouse
  • Specificity

    Does not cross-react with Ankyrin-B.

  • Tested applications

    Suitable for: IHC-Frmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Human
  • Immunogen

    Fusion protein corresponding to Human ANK-3 aa 873-2614. 92% identity.
    Sequence:

    EDAMTGDTDKYLGPQDLKELGDDSLPAEGYMGFSLGARSASLRSFSSDRS YTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSLRHYSWAADTLDN VNLVSSPIHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITC RLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRG KERELIVLRSENGETWKEHQFDSKNEDLTELLNGMDEELDSPEELGKKRI CRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALT KRIRVGLQAQPVPDEIVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPV PPPSGEGVSNGYKGDTTPNLRLLCSITGGTSPAQWEDITGTTPLTFIKDC VSFTTNVSARFWLADCHQVLETVGLATQLYRELICVPYMAKFVVFAKMND PVESSLRCFCMTDDKVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGN LAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKTTK GLPQTAVCNLNITLPAHKKIEKTDRRQSFASLALRKRYSYLTEPGMSPQS PCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSF MLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGTRS FADENNVFHDPVDDGPPVVTAEDASLEDSKLEDSVPLTEMPEAVDVDESQ LENVCLSWQNETSSGNLESCAQARRVTGGLLDRLDDSPDQCRDSITSYLK GEAGKFEANGSHTEITPEAKTKSYFPESQNDVGKQSTKETLKPKIHGSGH VEEPASPLAAYQKSLEETSKLIIEETKPCVPVSMKKMSRTSPADGKPRLS LHEEEGSSGSEQKQGEGFKVKTKKEIRHVEKKAH


    Database link: Q12955-6
    Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
  • Positive control

    • IHC-Fr: Rat axon initial segments, cortex, hippocampus CA1 tissue.
  • General notes

    Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

    Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

    We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

    In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

    We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

    Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

    Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Myeloma supernatant.
  • Concentration information loading...
  • Purity

    Tissue culture supernatant
  • Purification notes

    Myeloma supernatant.
  • Clonality

    Monoclonal
  • Clone number

    N106/43
  • Myeloma

    Sp2/0
  • Isotype

    IgG1
  • Research areas

    • Neuroscience
    • Neurotransmission
    • Intracellular Signaling
    • Cytoskeletal
    • Neuroscience
    • Cell Adhesion Proteins
    • Cytoskeletal Proteins
    • Regulation

Associated products

  • Compatible Secondaries

    • Goat Anti-Mouse IgG H&L (Alexa Fluor® 488) (ab150113)
    • Goat Anti-Mouse IgG H&L (HRP) (ab205719)

Applications

Our Abpromise guarantee covers the use of ab247206 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-Fr Use at an assay dependent concentration.

As a general guide the starting working concentration for the antibody should be used between 0.1 and 10 µg/mL. 

Target

  • Function

    In skeletal muscle, required for costamere localization of DMD and betaDAG1 (By similarity). Membrane-cytoskeleton linker. May participate in the maintenance/targeting of ion channels and cell adhesion molecules at the nodes of Ranvier and axonal initial segments. Regulates KCNA1 channel activity in function of dietary Mg(2+) levels, and thereby contributes to the regulation of renal Mg(2+) reabsorption (PubMed:23903368).
    Isoform 5: May be part of a Golgi-specific membrane cytoskeleton in association with beta-spectrin.
  • Tissue specificity

    Expressed in brain, neurons, muscles and other tissues.
  • Involvement in disease

    Genetic variations in ANK3 may be associated with autism spectrum disorders susceptibility.
    Mental retardation, autosomal recessive 37
  • Sequence similarities

    Contains 23 ANK repeats.
    Contains 1 death domain.
    Contains 2 ZU5 domains.
  • Developmental stage

    Up-regulated during muscle cell differentiation.
  • Domain

    The tandem configuration of the two ZU5 and the UPA domains forms a structural supramodule termed ZZU. ZU5-1 mediates interaction with beta-spectrin, and the ZU5-1/UPA interface is required for ankyrin's function other than binding to spectrin.
  • Cellular localization

    Cytoplasm, cytoskeleton. Cell projection, axon. Cell membrane, sarcolemma. Cell junction, synapse, postsynaptic cell membrane. Lysosome. In skeletal muscle, localized at costameres and neuromuscular junctions. In macrophages, associated with lysosomes and Cytoplasm, cytoskeleton. Golgi apparatus.
  • Target information above from: UniProt accession Q12955 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links

    • Entrez Gene: 288 Human
    • Entrez Gene: 361833 Rat
    • Omim: 600465 Human
    • SwissProt: Q12955 Human
    • SwissProt: O70511 Rat
    • Unigene: 499725 Human
    • Unigene: 690023 Human
    • Unigene: 731403 Human
    • Unigene: 740100 Human
    • Unigene: 211093 Rat
    see all
  • Alternative names

    • ANK-3 antibody
    • ANK3 antibody
    • ANK3_HUMAN antibody
    • ankyrin 3 (G) antibody
    • Ankyrin 3, node of Ranvier (ankyrin G) antibody
    • Ankyrin 3, node of Ranvier antibody
    • Ankyrin G antibody
    • Ankyrin G119 antibody
    • Ankyrin-3 antibody
    • Ankyrin-G antibody
    • brain specific ankyrin G antibody
    • CHANK3 antibody
    • FLJ45464 antibody
    • OTTHUMP00000217458 antibody
    • OTTHUMP00000217575 antibody
    • RP11 369L1.1 antibody
    see all

Images

  • Immunohistochemistry (Frozen sections) - Anti-ANK-3 antibody [N106/43] (ab247206)
    Immunohistochemistry (Frozen sections) - Anti-ANK-3 antibody [N106/43] (ab247206)

    Frozen sections of rat hippocampus CA1 tissue stained for ANK-3 using ab247206 in immunohistochemical analysis.

  • Immunohistochemistry (Frozen sections) - Anti-ANK-3 antibody [N106/43] (ab247206)
    Immunohistochemistry (Frozen sections) - Anti-ANK-3 antibody [N106/43] (ab247206)

    Frozen sections of rat axon initial segment tissue stained for ANK-3 using ab247206 in immunohistochemical analysis.

  • Immunohistochemistry (Frozen sections) - Anti-ANK-3 antibody [N106/43] (ab247206)
    Immunohistochemistry (Frozen sections) - Anti-ANK-3 antibody [N106/43] (ab247206)

    Frozen sections of rat cortex tissue stained for ANK-3 using ab247206 in immunohistochemical analysis.

  • Immunohistochemistry (Frozen sections) - Anti-ANK-3 antibody [N106/43] (ab247206)
    Immunohistochemistry (Frozen sections) - Anti-ANK-3 antibody [N106/43] (ab247206)

    Frozen sections of rat hippocampus CA1 tissue stained for ANK-3 using ab247206 in immunohistochemical analysis.

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab247206? Please let us know so that we can cite the reference in this datasheet.

    ab247206 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab247206.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.