Overview

  • Product name

  • Description

    Rabbit polyclonal to ANKRD1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ANKRD1 aa 264-319.
    Sequence:

    RYKMIRLLIMYGADLNIKNCAGKTPMDLVLHWQNGTKAIFDSLRENSYKT SRIATF


    Database link: Q15327

  • Positive control

    • IHC-P: Human heart muscle tissue. ICC/IF: U-2 OS cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab247009 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function

    May play an important role in endothelial cell activation. May act as a nuclear transcription factor that negatively regulates the expression of cardiac genes. Induction seems to be correlated with apoptotic cell death in hepatoma cells.
  • Tissue specificity

    Mainly expressed in activated vascular endothelial cells. To a lower extent, also expressed in hepatoma cells.
  • Involvement in disease

    Defects in ANKRD1 may be a cause of total anomalous pulmonary venous return (TAPVR) [MIM:106700]. TAPVR is a rare congenital heart disease (CHD) in which the pulmonary veins fail to connect to the left atrium during cardiac development, draining instead into either the right atrium or one of its venous tributaries. This disease accounts for 1.5% of all CHDs and has a prevalence of approximately 1 out of 15'000 live births.
  • Sequence similarities

    Contains 5 ANK repeats.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • ALRP antibody
    • ANKR1_HUMAN antibody
    • ANKRD 1 antibody
    • ANKRD1 antibody
    • Ankyrin repeat domain 1 (cardiac muscle) antibody
    • Ankyrin repeat domain containing protein 1 antibody
    • Ankyrin repeat domain-containing protein 1 antibody
    • bA320F15.2 antibody
    • C 193 antibody
    • C193 antibody
    • Cardiac ankyrin repeat protein antibody
    • CARP antibody
    • CVARP antibody
    • Cytokine inducible nuclear protein antibody
    • Cytokine-inducible gene C-193 protein antibody
    • Cytokine-inducible nuclear protein antibody
    • HA1A2 antibody
    • Liver ankyrin repeat domain 1 antibody
    • MCARP antibody
    • OTTHUMP00000020084 antibody
    see all

Images

  • PFA fixed, Triton X-100 permeabilized U-2 OS (Human bone osteosarcoma epithelial cell line) cells labeling ANKRD1 using ab247009 at 4 µg/ml (green) in ICC/IF.

  • Paraffin-embedded human heart tissue stained for ANKRD1 using ab247009 at 1/20 dilution in immunohistochemical analysis.
  • Paraffin-embedded human testis tissue stained for ANKRD1 using ab247009 at 1/20 dilution in immunohistochemical analysis. No positivity in cells in seminiferous ducts as expected.

References

ab247009 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab247009.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up