Anti-ANKRD37 antibody (ab220929)
Key features and details
- Rabbit polyclonal to ANKRD37
- Suitable for: ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-ANKRD37 antibody -
Description
Rabbit polyclonal to ANKRD37 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IFmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Cow
-
Immunogen
Recombinant fragment corresponding to Human ANKRD37 aa 21-84.
Sequence:ASVNAPPDPCKQSPVHLAAGSGLACFLLWQLQTGADLNQQDVLGEAPLHK AAKVGSLECLSLLV
Database link: Q7Z713 -
Positive control
- PC-3 cells
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab220929 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 0.25 - 2 µg/ml. |
Target
-
Tissue specificity
Mainly expressed in testis, small intestine, colon, blood leukocytes and in pancreatic adenocarcinoma cells. -
Sequence similarities
Contains 3 ANK repeats. -
Cellular localization
Nucleus. Cytoplasm. - Information by UniProt
-
Database links
- Entrez Gene: 509139 Cow
- Entrez Gene: 353322 Human
- Entrez Gene: 654824 Mouse
- Entrez Gene: 361149 Rat
- SwissProt: Q0VC93 Cow
- SwissProt: Q7Z713 Human
- SwissProt: Q569N2 Mouse
- Unigene: 508154 Human
see all -
Alternative names
- ANKRD37 antibody
- Ankyrin repeat domain 37 antibody
- Ankyrin repeat domain containing protein 37 antibody
see all
Images
-
Immunocytochemistry/ Immunofluorescence - Anti-ANKRD37 antibody (ab220929)Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized PC-3 cells labeling ANKRD37 with ab220929 at 4 µg/ml (green).
Protocols
Datasheets and documents
References (0)
ab220929 has not yet been referenced specifically in any publications.
