Overview

  • Product name

  • Description

    Rabbit polyclonal to ANKRD37
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human ANKRD37 aa 21-84.
    Sequence:

    ASVNAPPDPCKQSPVHLAAGSGLACFLLWQLQTGADLNQQDVLGEAPLHK AAKVGSLECLSLLV


    Database link: Q7Z713

  • Positive control

    • PC-3 cells

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220929 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Tissue specificity

    Mainly expressed in testis, small intestine, colon, blood leukocytes and in pancreatic adenocarcinoma cells.
  • Sequence similarities

    Contains 3 ANK repeats.
  • Cellular localization

    Nucleus. Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • ANKRD37 antibody
    • Ankyrin repeat domain 37 antibody
    • Ankyrin repeat domain containing protein 37 antibody
    • Ankyrin repeat domain-containing protein 37 antibody
    • ANR37_HUMAN antibody
    • hLrp2bp antibody
    • Low density lipoprotein receptor related protein 2 binding protein antibody
    • Low density lipoprotein receptor related protein binding protein antibody
    • Low-density lipoprotein receptor-related protein 2-binding protein antibody
    • LPR2BP antibody
    • MGC111507 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized PC-3 cells labeling ANKRD37 with ab220929 at 4 µg/ml (green).

References

ab220929 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220929.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up