Overview

  • Product name

    Anti-ANKS6 antibody
  • Description

    Rabbit polyclonal to ANKS6
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ANKS6 aa 1-132.
    Sequence:

    MGEGGLPPAFQLLLRACDQGDTETARRLLEPGAAEPAERGAEPEAGAEPA GAEVAGPGAAAAGAVGAPVPVDCSDEAGNTALQFAAAGGHEPLVRFLLRR GASVNSRNHYGWSALMQAARFGHVSVAHLLLD


    Database link: Q68DC2

  • Positive control

    • IHC: Human endometrial cancer tissue. ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab222851 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Function

    Required for renal function.
  • Sequence similarities

    Contains 11 ANK repeats.
    Contains 1 SAM (sterile alpha motif) domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • ANKRD14 antibody
    • Anks6 antibody
    • ANKS6_HUMAN antibody
    • ankyrin repeat and SAM domain containing protein 6 antibody
    • Ankyrin repeat and SAM domain-containing protein 6 antibody
    • Ankyrin repeat and sterile alpha motif domain containing 6 antibody
    • ankyrin repeat domain 14 antibody
    • ankyrin repeat domain containing protein 14 antibody
    • Ankyrin repeat domain-containing protein 14 antibody
    • SAM domain containing protein 6 antibody
    • SAM domain-containing protein 6 antibody
    • SamCystin antibody
    • SAMD6 antibody
    • sterile alpha motif domain containing 6 antibody
    • sterile alpha motif domain containing protein 6 antibody
    • Sterile alpha motif domain-containing protein 6 antibody
    see all

Images

  • Paraffin-embedded human endometrial cancer tissue stained for ANKS6 using ab222851 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for ANKS6 (green) using ab222851 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® congugated Goat Anti-Rabbit IgG (H+L).

References

ab222851 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222851.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up