Anti-Ankyrin repeat domain-containing protein 33 antibody (ab243427)

Overview

  • Product name

    Anti-Ankyrin repeat domain-containing protein 33 antibody
    See all Ankyrin repeat domain-containing protein 33 primary antibodies
  • Description

    Rabbit polyclonal to Ankyrin repeat domain-containing protein 33
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Ankyrin repeat domain-containing protein 33 aa 339-431.
    Sequence:

    SKSVPELLGTAPPPPLVPQSPPGSPQRSPWVFVPYQSPQGILSKCLQWLQ PRDSTSPRPQVPKILLSKASSSSHQCQPKPSPSGHQSLALPLW


    Database link: Q7Z3H0

  • Positive control

    • IHC-P: Human colon tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab243427 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.

Target

Images

  • Paraffin-embedded human colon cancer tissue stained for Ankyrin repeat domain-containing protein 33 using ab243427 at 1/20 dilution in immunohistochemical analysis.

References

ab243427 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243427.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up