Overview

  • Product name

    Anti-Annexin-13/ANXA13 antibody
    See all Annexin-13/ANXA13 primary antibodies
  • Description

    Rabbit polyclonal to Annexin-13/ANXA13
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ELISA, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Horse, Chicken, Guinea pig, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to Human Annexin-13/ANXA13 (N terminal).
    Sequence:

    IIEILSGRTSDERQQIKQKYKATYGKELEEVLKSELSGNFEKTALALLDR

  • Positive control

    • Jurkat cell lysate.
  • General notes

    This product was previously labelled as ANXA13

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab33066 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA 1/1.5625e+006.
WB Use a concentration of 2.5 µg/ml. Detects a band of approximately 39 kDa (predicted molecular weight: 35 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Tissue specificity

    Gut specific.
  • Sequence similarities

    Belongs to the annexin family.
    Contains 4 annexin repeats.
  • Domain

    A pair of annexin repeats may form one binding site for calcium and phospholipid.
  • Cellular localization

    Cell membrane. Associated with the plasma membrane of undifferentiated, proliferating crypt epithelial cells as well as differentiated villus enterocytes.
  • Information by UniProt
  • Database links

  • Alternative names

    • Annexin A13 antibody
    • Annexin XIII antibody
    • Annexin, intestine-specific antibody
    • Annexin-13 antibody
    • ANX 13 antibody
    • ANX A13 antibody
    • ANX13 antibody
    • ANX13_HUMAN antibody
    • ANXA13 antibody
    • Intestine Specific Annexin antibody
    • Intestine-specific annexin antibody
    • ISA antibody
    • MGC150460 antibody
    see all

Images

  • Anti-Annexin-13/ANXA13 antibody (ab33066) at 2.5 µg/ml + Jurkat cell lysate at 10 µg

    Secondary
    HRP conjugated anti Rabbit IgG at 1/50000 dilution

    Predicted band size: 35 kDa
    Observed band size: 39 kDa
    why is the actual band size different from the predicted?

References

This product has been referenced in:

  • Béaslas O  et al. Transcriptome response of enterocytes to dietary lipids: impact on cell architecture, signaling, and metabolism genes. Am J Physiol Gastrointest Liver Physiol 295:G942-52 (2008). WB ; Human . Read more (PubMed: 18755805) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab33066.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up