Overview

  • Product name
    Anti-Annexin-2 receptor/AXIIR antibody
  • Description
    Rabbit polyclonal to Annexin-2 receptor/AXIIR
  • Host species
    Rabbit
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to Human Annexin-2 receptor/AXIIR aa 1-50. (based on NP_001014301)
    Sequence:

    EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS

  • Positive control
    • Placental tissue lysate
  • General notes

    This product was previously labelled as AXIIR

     

Properties

Applications

Our Abpromise guarantee covers the use of ab76022 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 22 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • Function
    May act as a receptor for annexin II on marrow stromal cells to induce osteoclast formation.
  • Tissue specificity
    Widely expressed. Highly expressed in lymphocytes. Expressed in both resting CD4(+) and CD8(+) T-cells.
  • Information by UniProt
  • Database links
  • Alternative names
    • Annexin 2 receptor antibody
    • Annexin II receptor antibody
    • Annexin-2 receptor antibody
    • ANXA2R antibody
    • AX2R antibody
    • AX2R_HUMAN antibody
    • AXIIR antibody
    • C5orf39 antibody
    • Chromosome 5 open reading frame 39 antibody
    • LOC389289 antibody
    see all

Images

  • Anti-Annexin-2 receptor/AXIIR antibody (ab76022) at 1 µg/ml + Human placenta tissue lysate at 10 µg

    Secondary
    HRP-conjugated anti-rabbit IgG at 1/50000 dilution

    Predicted band size: 22 kDa
    Observed band size: 24 kDa
    why is the actual band size different from the predicted?

References

ab76022 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-3 of 3 Abreviews or Q&A

Answer

Thank you!

I will look forward to receiving the Abreviews soon.

Read More

Answer

Thank you for acceptance of Abreview collaboraiton.

Please note Abcam Abpromise guarantee does not cover this application. If the antibody does not work in functional assays it cannot be refunded. However you will still be getting a product free of charge if you submit abreview. Please read the terms and conditions carefully.

DISCOUNT CODE: xxxxxxxxxxxxx
Expiration date: 29-09-2012

I am very pleased to hear you would like to accept our offer and test ab76022 in [Functional assays]. This code will give you: 1 free [PRIMARY ANTIBODY/PROTEIN] OR VALUE OFF OF ORDER before the expiration date. To redeem this offer, please submit an Abreview for [Functional assay] and include this code in the “Additional Comments” section so we know the Abreview is for this promotion. Please remember that submission of the Abreview is sufficient for the discount code to become active.
For more information on how to submit an Abreview, please visit the site: www.abcam.com/Abreviews.

Remember, we publish both positive and negative Abreviews on our datasheets so please submit the results of your tests. The code will be active once the Abreview has been submitted and can be redeemed in one of the following ways: 1) Call to place your order and mention the code to our customer service department; 2) Include the code in your fax order; 3) Place your order on the web and enter the promotional code.

Any feedback that you can provide will be greatly appreciated, whether positive or negative. If you have any further questions, please do not hesitate to contact us. We look forward to receiving your Abreview and wish you luck with your research.

The terms and conditions applicable to this offer can be found here: https://www.abcam.com/collaborationdiscount.

Read More

Answer

rr/>
The Annexin-2 receptor is a trans-membrane type I protein; these types of proteins have N-terminal end in extracellular domain so this protein is extracellular.

We can provide Abreview discount code for ICC/IF and Functional assay (blocking) applications. Please select the application and cell type and contact us for discount code. Please read full terms and conditions;

https://www.abcam.com/index.html?pageconfig=resource&rid=11998&viapagetrap=collaborationdiscount
I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Use our products? Submit an Abreview. Earn rewards!
https://www.abcam.com/abreviews

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up