Description

  • Product name

    Annexin-2 receptor/AXIIR peptide
  • Animal free

    No
  • Nature

    Synthetic
    • Sequence

      EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS

Associated products

Specifications

Our Abpromise guarantee covers the use of ab103875 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Blocking - Blocking peptide for Anti-Annexin-2 receptor/AXIIR antibody (ab76022)

  • Form

    Liquid
  • Additional notes

    Previously labelled as LOC389289. 

     This product was previously labelled as AXIIR

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Constituent: dH2O

General Info

  • Alternative names

    • Annexin 2 receptor
    • Annexin II receptor
    • Annexin-2 receptor
    • ANXA2R
    • AX2R
    • AX2R_HUMAN
    • AXIIR
    • C5orf39
    • Chromosome 5 open reading frame 39
    • LOC389289
    see all
  • Function

    May act as a receptor for annexin II on marrow stromal cells to induce osteoclast formation.
  • Tissue specificity

    Widely expressed. Highly expressed in lymphocytes. Expressed in both resting CD4(+) and CD8(+) T-cells.
  • Information by UniProt

References

ab103875 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab103875.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up