Overview

  • Product name

    Anti-Annexin-4/ANXA4 antibody
    See all Annexin-4/ANXA4 primary antibodies
  • Description

    Rabbit polyclonal to Annexin-4/ANXA4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Rat, Dog
    Predicted to work with: Mouse, Cow, Human, Pig
  • Immunogen

    Recombinant fragment corresponding to Dog Annexin-4/ANXA4 aa 150-313. (Expressed in E.coli).
    Sequence:

    RVLVSLSAGGRDEGNFLDDALMRQDAQDLYEAGEKKWGTDEVKFLTVLCS RNRNHLLHVFDEYKRISQKDIEQGIKSETSGSFEDALLAIVKCMRNKSAY FAERLYKSMKGLGTDDNTLIRVMVSRAEIDMMDIRESFKRLYGKSLYSFI KGDTSGDYRKVLLI


    Database link: P50994

  • Positive control

    • WB: Dog stomach and liver lysates; Rat placenta lysate; Recombinant dog Annexin IV/ANXA4 protein.
  • General notes

    This product was previously labelled as Annexin IV/ANXA4

     

Properties

Applications

Our Abpromise guarantee covers the use of ab232836 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 36 kDa.

Target

  • Function

    Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis.
  • Sequence similarities

    Belongs to the annexin family.
    Contains 4 annexin repeats.
  • Domain

    A pair of annexin repeats may form one binding site for calcium and phospholipid.
  • Information by UniProt
  • Database links

  • Alternative names

    • 35 beta calcimedin antibody
    • 35-beta calcimedin antibody
    • AIV antibody
    • Annexin 4 antibody
    • Annexin A4 antibody
    • Annexin IV (placental anticoagulant protein II) antibody
    • Annexin IV antibody
    • Annexin IV placental anticoagulant protein II antibody
    • Annexin-4 antibody
    • AnnexinA4 antibody
    • AnnexinIV antibody
    • ANX 4 antibody
    • ANX A4 antibody
    • ANX4 antibody
    • ANXA 4 antibody
    • ANXA4 antibody
    • ANXA4 protein antibody
    • ANXA4_HUMAN antibody
    • Carbohydrate binding protein P33/P41 antibody
    • Carbohydrate-binding protein p33/p41 antibody
    • Chromobindin 4 antibody
    • Chromobindin-4 antibody
    • Chromobindin4 antibody
    • DKFZp686H02120 antibody
    • Endonexin I antibody
    • EndonexinI antibody
    • Lipocortin IV antibody
    • LipocortinIV antibody
    • MGC75105 antibody
    • OTTHUMP00000160052 antibody
    • OTTHUMP00000202207 antibody
    • P32.5 antibody
    • P33/41 antibody
    • PAP II antibody
    • PAP-II antibody
    • PAPII antibody
    • PIG 28 antibody
    • PIG28 antibody
    • Placental anticoagulant protein II antibody
    • PP4 X antibody
    • PP4-X antibody
    • PP4X antibody
    • Proliferation inducing gene 28 antibody
    • Proliferation inducing protein 28 antibody
    • Protein II antibody
    • Xanx-4 antibody
    • ZAP 36 antibody
    • ZAP36 antibody
    see all

Images

  • Anti-Annexin-4/ANXA4 antibody (ab232836) at 2 µg/ml + Recombinant dog Annexin IV/ANXA4 protein

    Predicted band size: 36 kDa

  • Anti-Annexin-4/ANXA4 antibody (ab232836) at 2 µg/ml + Dog stomach lysate

    Predicted band size: 36 kDa

  • Anti-Annexin-4/ANXA4 antibody (ab232836) at 2 µg/ml + Dog liver lysate

    Predicted band size: 36 kDa

  • Anti-Annexin-4/ANXA4 antibody (ab232836) at 2 µg/ml + Rat placenta lysate

    Predicted band size: 36 kDa

References

ab232836 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232836.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up