Anti-Annexin A1/ANXA1 antibody (ab232790)
Key features and details
- Rabbit polyclonal to Annexin A1/ANXA1
- Suitable for: WB
- Reacts with: Pig
- Isotype: IgG
Overview
-
Product name
Anti-Annexin A1/ANXA1 antibody
See all Annexin A1/ANXA1 primary antibodies -
Description
Rabbit polyclonal to Annexin A1/ANXA1 -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Pig
Predicted to work with: Cow, Human, Chimpanzee, Orangutan -
Immunogen
Recombinant fragment (His-tag) corresponding to Pig Annexin A1/ANXA1 aa 208-336. Expressed in E. coli. N-terminal tag.
Sequence:EAGERRKGTDLNVFITILTTRSYLHLRRVFQKYSKYSKHDMNKVLDLELK GDIENCLTVVVKCATSKPMFFAEKLHQAMKGNGTRHKTLIRIMVSRSEID MNDIKACYQKLYGISLCQAILDETKGDYE
Database link: P19619 -
Positive control
- WB: Recombinant porcine Annexin A1 protein. Porcine intestine tissue lysate.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Protein A purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab232790 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.5 - 2 µg/ml. |
Target
-
Function
Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis. This protein regulates phospholipase A2 activity. It seems to bind from two to four calcium ions with high affinity. -
Sequence similarities
Belongs to the annexin family.
Contains 4 annexin repeats. -
Domain
A pair of annexin repeats may form one binding site for calcium and phospholipid. -
Post-translational
modificationsPhosphorylated by protein kinase C, epidermal growth factor receptor/kinase and TRPM7. Phosphorylation results in loss of the inhibitory activity. -
Cellular localization
Nucleus. Cytoplasm. Cell projection > cilium. Basolateral cell membrane. Found in the cilium, nucleus and basolateral cell membrane of ciliated cells in the tracheal endothelium (By similarity). Found in the cytoplasm of type II pneumocytes and alveolar macrophages. - Information by UniProt
-
Database links
- Entrez Gene: 472953 Chimpanzee
- Entrez Gene: 327662 Cow
- Entrez Gene: 301 Human
- Entrez Gene: 100171684 Orangutan
- Entrez Gene: 396942 Pig
- Omim: 151690 Human
- SwissProt: A5A6M2 Chimpanzee
- SwissProt: P46193 Cow
see all -
Alternative names
- Annexin 1 antibody
- Annexin A1 antibody
- Annexin I (lipocortin I) antibody
see all
Images
-
Anti-Annexin A1/ANXA1 antibody (ab232790) at 1 µg/ml + Porcine intestine tissue lysate.
Secondary
HRP-linked Guinea pig anti-Rabbit at 1/2000 dilution -
Anti-Annexin A1/ANXA1 antibody (ab232790) at 1 µg/ml + Recombinant porcine Annexin A1 protein.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab232790 has not yet been referenced specifically in any publications.