Overview

  • Product name
    Anti-Annexin A3/ANXA3 antibody
    See all Annexin A3/ANXA3 primary antibodies
  • Description
    Rabbit polyclonal to Annexin A3/ANXA3
  • Host species
    Rabbit
  • Tested applications
    Suitable for: ELISA, WB, IHC-P, ICC/IF, IHC - Wholemountmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Rabbit, Horse
  • Immunogen

    Synthetic peptide corresponding to Human Annexin A3/ANXA3 aa 1-50 (N terminal).
    Sequence:

    MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSN

  • Positive control
    • WB: Placenta lysate. IHC-P: Human spleen tissue.
  • General notes

     This product was previously labelled as Annexin A3

     

Properties

Applications

Our Abpromise guarantee covers the use of ab33068 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ELISA 1/62500.
WB Use a concentration of 1.25 µg/ml. Detects a band of approximately 36 kDa (predicted molecular weight: 36 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P Use at an assay dependent concentration.
ICC/IF Use at an assay dependent concentration. Used at a dilution of 1/100 for 1 hr incubation on mouse cartilage (see Abreview for further information).
IHC - Wholemount Use at an assay dependent concentration.

Target

  • Function
    Inhibitor of phospholipase A2, also possesses anti-coagulant properties. Also cleaves the cyclic bond of inositol 1,2-cyclic phosphate to form inositol 1-phosphate.
  • Sequence similarities
    Belongs to the annexin family.
    Contains 4 annexin repeats.
  • Domain
    A pair of annexin repeats may form one binding site for calcium and phospholipid.
  • Information by UniProt
  • Database links
  • Alternative names
    • 2-cyclic phosphate 2-phosphohydrolase antibody
    • 35-alpha calcimedin antibody
    • Annexin A3 antibody
    • Annexin III antibody
    • Annexin-3 antibody
    • ANX3 antibody
    • ANXA 3 antibody
    • Anxa3 antibody
    • ANXA3_HUMAN antibody
    • Calcimedin 35 alpha antibody
    • Inositol 1 2 cyclic phosphate 2 phosphohydrolase antibody
    • Inositol 1 antibody
    • Lipocortin III antibody
    • OTTHUMP00000160701 antibody
    • OTTHUMP00000219237 antibody
    • OTTHUMP00000219238 antibody
    • PAP III antibody
    • PAP-III antibody
    • Placental anticoagulant protein III antibody
    see all

Images

  • Anti-Annexin A3/ANXA3 antibody (ab33068) at 1.25 µg/ml + placenta lysate at 10 µg

    Secondary
    HRP conjugated anti Rabbit IgG at 1/50000 dilution

    Predicted band size: 36 kDa
    Observed band size: 36 kDa
    Additional bands at: 45 kDa. We are unsure as to the identity of these extra bands.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human spleen tissue labelling Annexin A3/ANXA3 with ab33068 at 4µg/ml. Positively labelled cells indicated by arrows. Magnification: 400X.

References

This product has been referenced in:
  • Subhasitanont P  et al. Apigenin inhibits growth and induces apoptosis in human cholangiocarcinoma cells. Oncol Lett 14:4361-4371 (2017). Read more (PubMed: 28943950) »
  • Qu S  et al. Protein expression of nucleophosmin, annexin A3 and nm23-H1 correlates with human nasopharyngeal carcinoma radioresistance in vivo. Oncol Lett 12:615-620 (2016). IHC-P ; Human . Read more (PubMed: 27347189) »
See all 6 Publications for this product

Customer reviews and Q&As

Filter by Application

Filter by Species

Filter by Ratings

1-3 of 3 Abreviews

Application
Immunoprecipitation
Sample
Mouse Tissue lysate - whole (placenta)
Total protein in input
3600 µg
Immuno-precipitation step
Protein A
Specification
placenta

Abcam user community

Verified customer

Submitted Oct 02 2015

Application
IHC - Wholemount
Sample
Mouse Embryo (Whole mouse embryo)
Specification
Whole mouse embryo

Abcam user community

Verified customer

Submitted Feb 24 2012

Application
Immunocytochemistry/ Immunofluorescence
Sample
Mouse Cell (cartilage)
Specification
cartilage
Blocking step
BSA as blocking agent for 20 minute(s) · Concentration: 5
Fixative
Methanol

Abcam user community

Verified customer

Submitted Jul 13 2006

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"
For licensing inquiries, please contact partnerships@abcam.com

Sign up