Overview

  • Product name

    Anti-Annexin V/ANXA5 antibody
    See all Annexin V/ANXA5 primary antibodies
  • Description

    Rabbit polyclonal to Annexin V/ANXA5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Chicken
  • Immunogen

    Recombinant full length protein (His-tag) corresponding to Chicken Annexin V/ANXA5 aa 1-321. Expressed in E.coli.
    Sequence:

    MGHHHHHHSGSMAKYTRGTVTAFSPFDARADAEALRKAMKGMGTDEETIL KILTSRNNAQRQEIASAFKTLFGRDLVDDLKSELTGKFETLMVSLMRPAR IFDAHALKHAIKGAGTNEKVLTEILASRTPAEVQNIKQVYMQEYEANLED KITGETSGHFQRLLVVLLQANRDPDGRVDEALVEKDAQVLFRAGELKWGT DEETFITILGTRSVSHLRRVFDKYMTISGFQIEETIDRETSGDLEKLLLA VVKCIRSVPAYFAETLYYSMKGAGTDDDTLIRVMVSRSEIDLLDIRHEFR KNFAKSLYQMIQKDTSGDYRKALLLLCGGDDE


    Database link: P17153

  • Positive control

    • WB: Recombinant chicken Annexin V/ANXA5; chicken heart, lung and brain lysates.
  • General notes

     This product was previously labelled as Annexin V

     

Properties

Applications

Our Abpromise guarantee covers the use of ab231231 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 36 kDa.

Target

  • Function

    This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade.
  • Involvement in disease

    Pregnancy loss, recurrent, 3
  • Sequence similarities

    Belongs to the annexin family.
    Contains 4 annexin repeats.
  • Domain

    The [IL]-x-C-x-x-[DE] motif is a proposed target motif for cysteine S-nitrosylation mediated by the iNOS-S100A8/A9 transnitrosylase complex.
    A pair of annexin repeats may form one binding site for calcium and phospholipid.
  • Post-translational
    modifications

    S-nitrosylation is induced by interferon-gamma and oxidatively-modified low-densitity lipoprotein (LDL(ox)) possibly implicating the iNOS-S100A8/9 transnitrosylase complex.
  • Information by UniProt
  • Database links

  • Alternative names

    • Anchorin CII antibody
    • Annexin 5 antibody
    • Annexin A5 antibody
    • Annexin V antibody
    • Annexin-5 antibody
    • Annexin5 antibody
    • AnnexinA5 antibody
    • AnnexinV antibody
    • ANX 5 antibody
    • ANX A5 antibody
    • ANX5 antibody
    • ANXA5 antibody
    • ANXA5_HUMAN antibody
    • Calphobindin I antibody
    • CBP-I antibody
    • Endonexin II antibody
    • ENX 2 antibody
    • ENX2 antibody
    • Lipocortin V antibody
    • PAP I antibody
    • PAP-I antibody
    • Placental anticoagulant protein 4 antibody
    • Placental anticoagulant protein I antibody
    • PLACENTAL PROTEIN 4 antibody
    • PP 4 antibody
    • Pp4 antibody
    • RPRGL3 antibody
    • Thromboplastin inhibitor antibody
    • VAC-alpha antibody
    • Vascular anticoagulant-alpha antibody
    see all

Images

  • Anti-Annexin V/ANXA5 antibody (ab231231) at 2 µg/ml + Recombinant chicken Annexin V/ANXA5

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 36 kDa

  • All lanes : Anti-Annexin V/ANXA5 antibody (ab231231) at 2 µg/ml

    Lane 1 : Chicken lung lysate
    Lane 2 : Chicken brain lysate
    Lane 3 : Chicken heart lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 36 kDa

References

ab231231 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231231.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up